KEGG   Rattus norvegicus (rat): 58977Help
Entry
58977             CDS       T01003                                 

Gene name
Ppp1r1a
Definition
(RefSeq) protein phosphatase 1, regulatory (inhibitor) subunit 1A
  KO
K08050  protein phosphatase 1 regulatory subunit 1A
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04720  Long-term potentiation
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    58977 (Ppp1r1a)
  09156 Nervous system
   04720 Long-term potentiation
    58977 (Ppp1r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    58977 (Ppp1r1a)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     58977 (Ppp1r1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DARPP-32
Motif
Other DBs
NCBI-GeneID: 58977
NCBI-ProteinID: NP_073167
RGD: 62018
Ensembl: ENSRNOG00000036827
UniProt: P19103
Position
7q36
AA seq 171 aa AA seqDB search
MEPDNSPRKIQFTVPLLEPHLDPEAAEQIRRRRPTPATLVLTSDQSSPEVDEDRIPNPLL
KSTLSMSPRQRKKMTRTTPTMKELQTMVEHHLGQQKQGEEPEGATESTGNQESCPPGIPD
TGSASRPDTSGTAQKPAESKPKTQEQRGVEPSTEDLSAHMLPLDSQGASLV
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgacaacagtccacggaagatccagtttacggttccgctgctggagcctcac
ctggacccggaggcagccgagcagattcggaggcgccgccccacccctgccacacttgtg
ctgaccagcgaccagtcatccccagaagtagatgaagaccggatccccaacccacttctc
aagtccacactgtcaatgtctccacggcaacggaagaagatgacaaggactacacccacc
atgaaagagctccagacaatggttgaacatcacctagggcaacagaaacaaggggaagaa
cctgagggagccactgagagcacagggaaccaggagtcctgcccacctgggatcccagac
acaggctcagcgtcaaggccagatacctcggggacagcacaaaagcctgcagaatccaaa
cccaagactcaggagcagcgtggtgtggagcccagcacagaggacctttcagcccacatg
ctaccactggattcccaaggagccagcttggtctga

DBGET integrated database retrieval system