KEGG   Rattus norvegicus (rat): 59075Help
Entry
59075             CDS       T01003                                 

Gene name
Grk5, Gprk5
Definition
(RefSeq) G protein-coupled receptor kinase 5
  KO
K08291  G protein-coupled receptor kinase [EC:2.7.11.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    59075 (Grk5)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    59075 (Grk5)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    59075 (Grk5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    59075 (Grk5)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.16  G-protein-coupled receptor kinase
     59075 (Grk5)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: AGC group
  GRK family [OT]
   59075 (Grk5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr RGS Kinase-like Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 59075
NCBI-ProteinID: NP_110456
RGD: 61985
Ensembl: ENSRNOG00000011439
UniProt: Q62833
Position
1q55
AA seq 590 aa AA seqDB search
MELENIVANTVLLKAREGGGGKRKGKSKKWKEILKFPHINQCEDLRRTIDRDYYSLCDKQ
PIGRLLFRQFCETRPGLECYIQFLDLVAEYEITPDENLGAKGKEIMTKYLSPKSPVFIAQ
VGQDLVSQTEKKLLQSPCKELFSACAQSVHDYLKGDPFHEYLDSMYFDRFLQWKWLERQP
VTKNTFRQYRVLGKGGFGEVCACQVRATGKMYACKRLEKKRIKKRKGESMALNEKQILEK
VNSQFVVNLAYAYETKDALCLVLTIMNGGDLKFHIYNMGNPGFEEERALFYAAEILCGLE
DLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEGDLIRGRVGTVGYMAPEVLNNQ
RYGLSPDYWGLGCLIYEMIEGQSPFRGRKEKVKREEVDRRVLETEEVYSPKFSEEAKSIC
NMLLTKDSKQRLGCQEEGAAEVKRHPFFRNMNFKRLEAGMLDPPFVPDPRAVYCKDVLDI
EQFSTVKGVNLDHTDDDFYSKFSTGSVPIPWQNEMIETECFKELNVFGPNGTLSPDLNRS
QPPEPPKKGLFHRLFRRQHQNNSKSSPTPKTSCNHRINSNHINSNSTGSS
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atggagctggaaaacatcgtggccaacacggtcttgctgaaagcccgggaagggggtgga
ggaaaacgcaaagggaaaagcaagaagtggaaggaaatcctgaagtttcctcacatcaac
cagtgtgaagacctccggagaaccatagacagagattactacagtctatgtgacaagcaa
ccaattgggagactgctttttcgacaattctgtgaaaccaggcctggactggagtgctac
attcagttcctggacttagtggcagaatatgaaattactccagatgaaaaccttggggca
aaggggaaggaaataatgaccaagtacctctctccaaagtccccagtcttcattgcccaa
gttggacaggacctggtctcccagacagagaagaagctcctgcagagcccctgcaaagaa
ctcttctctgcttgtgctcagtctgtccatgactacttgaagggagaccccttccacgag
tacctggacagcatgtattttgaccgttttctgcagtggaaatggttagaaagacaacca
gtgaccaaaaacactttccggcagtaccgagtgctgggcaaagggggctttggagaggtt
tgtgcctgccaggttcgggccactggtaaaatgtatgcttgcaaacgcttagagaagaag
aggatcaaaaaaaggaaaggagagtccatggcactcaatgaaaagcagattcttgagaaa
gtcaacagccagtttgtggtcaacctggcctatgcctacgagaccaaagatgcactgtgc
ttggttctgaccattatgaatggaggtgacctgaagtttcacatctacaacatgggaaat
cctggctttgaggaagaacgagccttgttttatgcagctgagatcctctgtggcctggaa
gacttacaccgtgagaacactgtctatagagatctaaaaccagaaaacatcttgctggat
gattatggccacatcaggatctcagacctaggactggctgtgaagatccctgagggggac
cttatccgtggccgggtaggcactgttggctacatggccccagaagttctgaacaaccag
cgatatggcctgagccctgactactggggcctgggctgcctcatctatgagatgatcgag
ggccagtcaccattccgaggccgcaaggagaaggtgaagcgggaagaggtggatcgccgg
gtgctggagactgaggaagtgtattcccccaagttctctgaagaggccaagtccatctgc
aacatgctgctcaccaaagactcgaagcagaggctgggctgccaggaggagggggctgcc
gaggtcaagaggcaccccttcttcaggaacatgaactttaaacgcctggaggctgggatg
ttggaccctcccttcgttccagatccccgggctgtatactgcaaggatgtgctggacata
gagcagttctccactgtgaaaggtgtcaacttggaccatacggacgatgacttctactca
aagttctccacaggctctgtgccaatcccatggcaaaacgagatgatagaaacagaatgt
ttcaaggagctgaatgtgttcggacccaacggtaccctctcaccagacctgaacagaagt
cagcctccagaaccaccaaagaaagggctgttccacagactcttcaggcgtcagcatcaa
aacaattccaagagttcacctactcctaagaccagttgtaaccaccgcataaattcaaac
cacatcaattcaaactccactggaagcagctag

DBGET integrated database retrieval system