KEGG   Rattus norvegicus (rat): 59085Help
Entry
59085             CDS       T01003                                 

Gene name
Asl
Definition
(RefSeq) argininosuccinate lyase
  KO
K01755  argininosuccinate lyase [EC:4.3.2.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00220  Arginine biosynthesis
rno00250  Alanine, aspartate and glutamate metabolism
rno01100  Metabolic pathways
rno01230  Biosynthesis of amino acids
Module
rno_M00029  Urea cycle
rno_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    59085 (Asl)
   00220 Arginine biosynthesis
    59085 (Asl)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    59085 (Asl)
Enzymes [BR:rno01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.2  Amidine-lyases
    4.3.2.1  argininosuccinate lyase
     59085 (Asl)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   59085 (Asl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lyase_1 ASL_C2 T4SS_CagC
Motif
Other DBs
NCBI-GeneID: 59085
NCBI-ProteinID: NP_067588
RGD: 619974
Ensembl: ENSRNOG00000000903
UniProt: P20673 Q4QRB8
Position
12q12
AA seq 461 aa AA seqDB search
MASESGKLWGGRFAGSVDPTMDKFNSSIAYDRHLWNVDLQGSKAYSRGLEKAGLLTKAEM
QQILQGLDKVAEEWAQGIFKLYPNDEDIHTANERRLKELIGEAAGKLHTGRSRNDQVVTD
LRLWMRQTCSKLSTFLKVLIEAMVDRAEAECEVLFPGYTHLQRAQPIRWSHWILSHAVAL
TRDLERLKEVQKRINVLPLGSGAIAGNPLGVDREFLCAELNFGAITLNSMDATSERDFVA
EFLFWASLCMTHLSRMAEDLILYGTKEFNFVQLSDAYSTGSSLMPQKKNPDSLELIRSKA
GRVFGRCAGLLMTLKGLPSTYNKDLQEDKEAVFEVSDTMTAVLQVATGVISTLQIHRENM
AQALSPDMLATDLAYYLVRKGMPFRQAHEASGKAVVVAEMKGVALNQLSLQELQTVSPLF
SSDVNLVWDYSHSVEQYTALGGTAQSSVEWQISQVRALLQM
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggagagcgggaagctatggggtggccgatttgcaggctcggtcgaccccacc
atggacaagttcaactcatctatcgcctatgaccggcatctgtggaatgtggacctgcag
ggaagcaaggcctacagcaggggcctggagaaggcagggcttctcaccaaagctgagatg
cagcagatactgcaaggcctggacaaggtggctgaagagtgggcccaaggcatcttcaaa
ttgtaccctaatgatgaagacatccacacggccaacgagcggcgcctgaaggaactcatt
ggtgaagctgcagggaagttacacacaggcagaagtcgcaatgaccaggtggtcacggac
ctcaggctgtggatgaggcaaacctgctcaaaactctccaccttcctcaaggtgctcatt
gaagccatggtagaccgggcagaggcggagtgtgaagtcctcttccctgggtacacacac
ttgcagagagctcagcccatccgctggagccactggatcctgagtcacgccgttgcgctg
acacgagatttagagagactgaaggaggtgcagaagcggatcaatgtcctgccactgggc
agtggggccattgcaggcaaccctctgggtgtggaccgggagttcctctgtgcagaactg
aactttggagccattacgctcaacagtatggatgccaccagcgagagagacttcgtggct
gagttcctgttttgggcttctctgtgcatgacccatctcagcaggatggcagaagacctg
attctctacggtaccaaggaattcaactttgtgcagctctccgatgcctacagcaccgga
agcagcttgatgccccagaagaaaaacccagacagcttggagctgatccggagcaaggcg
ggccgagtgtttggacggtgcgcaggactcctgatgaccctcaagggacttccaagcacc
tacaacaaggacttacaggaagacaaggaggctgtgtttgaagtgtctgacaccatgaca
gctgtcctccaagtagccactggagtcatctctacactgcagattcatcgtgagaacatg
gcacaggcactcagccctgacatgctggctaccgaccttgcctactacctggtccgcaaa
gggatgccattccgccaggcccacgaggcctcagggaaagctgtggtcgtggcagagatg
aaaggggtggctctcaaccagctgtcacttcaggagctgcagaccgtcagtcccctgttc
tcgagtgacgtgaatctcgtgtgggactacagccacagcgtggagcagtacacagccttg
ggtggcacagcacagtccagtgttgagtggcagatcagccaggtgcgggccctgctgcag
atgtag

DBGET integrated database retrieval system