KEGG   Rattus norvegicus (rat): 59086
Entry
59086             CDS       T01003                                 

Gene name
Tgfb1
Definition
(RefSeq) transforming growth factor beta-1 proprotein precursor
  KO
K13375  transforming growth factor beta-1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04068  FoxO signaling pathway
rno04110  Cell cycle
rno04218  Cellular senescence
rno04350  TGF-beta signaling pathway
rno04380  Osteoclast differentiation
rno04390  Hippo signaling pathway
rno04659  Th17 cell differentiation
rno04672  Intestinal immune network for IgA production
rno04926  Relaxin signaling pathway
rno04932  Non-alcoholic fatty liver disease
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05140  Leishmaniasis
rno05142  Chagas disease
rno05144  Malaria
rno05145  Toxoplasmosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05166  Human T-cell leukemia virus 1 infection
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
rno05210  Colorectal cancer
rno05211  Renal cell carcinoma
rno05212  Pancreatic cancer
rno05220  Chronic myeloid leukemia
rno05225  Hepatocellular carcinoma
rno05226  Gastric cancer
rno05321  Inflammatory bowel disease
rno05323  Rheumatoid arthritis
rno05410  Hypertrophic cardiomyopathy
rno05414  Dilated cardiomyopathy
rno05415  Diabetic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    59086 (Tgfb1)
   04350 TGF-beta signaling pathway
    59086 (Tgfb1)
   04390 Hippo signaling pathway
    59086 (Tgfb1)
   04068 FoxO signaling pathway
    59086 (Tgfb1)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    59086 (Tgfb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    59086 (Tgfb1)
   04218 Cellular senescence
    59086 (Tgfb1)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    59086 (Tgfb1)
   04672 Intestinal immune network for IgA production
    59086 (Tgfb1)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    59086 (Tgfb1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    59086 (Tgfb1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    59086 (Tgfb1)
   05205 Proteoglycans in cancer
    59086 (Tgfb1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    59086 (Tgfb1)
   05212 Pancreatic cancer
    59086 (Tgfb1)
   05225 Hepatocellular carcinoma
    59086 (Tgfb1)
   05226 Gastric cancer
    59086 (Tgfb1)
   05220 Chronic myeloid leukemia
    59086 (Tgfb1)
   05211 Renal cell carcinoma
    59086 (Tgfb1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    59086 (Tgfb1)
   05161 Hepatitis B
    59086 (Tgfb1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    59086 (Tgfb1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    59086 (Tgfb1)
   05144 Malaria
    59086 (Tgfb1)
   05145 Toxoplasmosis
    59086 (Tgfb1)
   05140 Leishmaniasis
    59086 (Tgfb1)
   05142 Chagas disease
    59086 (Tgfb1)
  09163 Immune disease
   05323 Rheumatoid arthritis
    59086 (Tgfb1)
   05321 Inflammatory bowel disease
    59086 (Tgfb1)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    59086 (Tgfb1)
   05414 Dilated cardiomyopathy
    59086 (Tgfb1)
   05415 Diabetic cardiomyopathy
    59086 (Tgfb1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    59086 (Tgfb1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    59086 (Tgfb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:rno03110]
    59086 (Tgfb1)
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    59086 (Tgfb1)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    59086 (Tgfb1)
Chaperones and folding catalysts [BR:rno03110]
 Intramolecular chaperones
  Others
   59086 (Tgfb1)
Cytokines and growth factors [BR:rno04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   59086 (Tgfb1)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   59086 (Tgfb1)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 59086
NCBI-ProteinID: NP_067589
RGD: 69051
Ensembl: ENSRNOG00000020652
UniProt: P17246
Position
1
AA seq 390 aa
MPPSGLRLLPLLLPLPWLLVLTPGRPAAGLSTCKTIDMELVKRKRIEAIRGQILSKLRLA
SPPSQGEVPPGPLPEAVLALYNSTRDRVAGESADPEPEPEADYYAKEVTRVLMVDRNNAI
YDKTKDITHSIYMFFNTSDIREAVPEPPLLSRAELRLQRFKSTVEQHVELYQKYSNNSWR
YLGNRLLTPTDTPEWLSFDVTGVVRQWLNQGDGIQGFRFSAHCSCDSKDNVLHVEINGIS
PKRRGDLGTIHDMNRPFLLLMATPLERAQHLHSSRHRRALDTNYCFSSTEKNCCVRQLYI
DFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASASPCCVPQA
LEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
NT seq 1173 nt   +upstreamnt  +downstreamnt
atgccgccctcggggctgcggctgctgccgcttctgctcccactcccgtggcttctagtg
ctgacgcccgggaggccagccgcgggactctccacctgcaagaccatcgacatggagctg
gtgaaacggaagcgcatcgaagccatccgtggccagatcctgtccaaactaaggctcgcc
agtcccccgagccagggggaggtaccgccgggcccgctgcccgaggcggtgctcgctttg
tacaacagcacccgcgaccgggtggcaggcgagagcgctgacccggagcccgagcccgag
gcggactactacgccaaagaagtcacccgcgtgctaatggtggaccgcaacaacgcaatc
tatgacaaaaccaaagacatcacacacagtatatatatgttcttcaatacgtcagacatt
cgggaagcagtgccagaacccccattgctgtcccgtgcagagctgcgcctgcagagattc
aagtcaactgtggagcaacacgtagaactctaccagaaatatagcaacaattcctggcgt
taccttggtaaccggctgctgacccccactgatacgcctgagtggctgtcttttgacgtc
actggagttgtccggcagtggctgaaccaaggagacggaatacagggctttcgcttcagt
gctcactgctcttgtgacagcaaagataatgtactccacgtggaaatcaatgggatcagt
cccaaacgtcgaggtgacctgggcaccatccatgacatgaaccgacccttcctgctcctc
atggccacccccctggaaagggctcaacacctgcacagctccaggcaccggagagccctg
gataccaactactgcttcagctccacagagaagaactgctgtgtacggcagctgtacatt
gactttaggaaggacctgggttggaagtggatccacgagcccaagggctaccatgccaac
ttctgtctggggccctgcccctacatttggagcctggacacacagtacagcaaggtcctt
gccctctacaaccaacacaacccgggtgcttccgcatcaccgtgctgcgtgccgcaggct
ttggagccactgcccatcgtctactacgtgggtcgcaagcccaaggtggagcagttgtcc
aacatgatcgtgcgctcctgcaagtgcagctga

DBGET integrated database retrieval system