KEGG   Rattus norvegicus (rat): 59087Help
Entry
59087             CDS       T01003                                 

Gene name
Nxf1, Mex67h, Tap
Definition
(RefSeq) nuclear RNA export factor 1
  KO
K14284  nuclear RNA export factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03008  Ribosome biogenesis in eukaryotes
rno03013  RNA transport
rno03015  mRNA surveillance pathway
rno05164  Influenza A
rno05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    59087 (Nxf1)
   03015 mRNA surveillance pathway
    59087 (Nxf1)
   03008 Ribosome biogenesis in eukaryotes
    59087 (Nxf1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    59087 (Nxf1)
   05168 Herpes simplex virus 1 infection
    59087 (Nxf1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rno03019]
    59087 (Nxf1)
   03009 Ribosome biogenesis [BR:rno03009]
    59087 (Nxf1)
Messenger RNA biogenesis [BR:rno03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     59087 (Nxf1)
   mRNA cycle factors
    Stress granule specific factors
     59087 (Nxf1)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    59087 (Nxf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tap-RNA_bind NTF2 TAP_C LRR_8 LRR_4 LRR_9
Motif
Other DBs
NCBI-GeneID: 59087
NCBI-ProteinID: NP_067590
RGD: 62014
Ensembl: ENSRNOG00000019069
UniProt: O88984
Position
1q43
AA seq 618 aa AA seqDB search
MADEGKSYNEHDDRVSFPQRRKKGRGPFRWKCGVGNRRSGRGGSGIRSSRFEEDDGDVAM
NDPQDGPRVRFNPYTTRPNRRRDTWHDRDRIHVTVRRDRAPQERGGAGTSQDGTTKNWFK
ITIPYGKKYDKMWLLSMIQSKCSVPFNPIEFHYENTRAHFFVENATTASALKAVNYKIQD
RENGRISIIINSSAPPYIVQNELKPEQVEQLKLIMSKRYDGSQQALDLKGLRSDPDLVAQ
NIDVVLNRRGCMAAALRIIEENIPELLSLNLSNNRLYKLDDMSSIVQKAPNLKILNLSGN
ELKSEWELDKIKGLKLEELWLDRNPMCDTFLDQSTYISTIRERFPKLLRLDGHELPPPIA
FDVEAPTMLPPCKGSYFGTENLKSLVLHFLQQYYAIYDSGDRQGLLDAYHDGACCSLSTP
SNPQNPVRHNLAKYFNDSRNVKKIKDTTTRFRLLKHTRLNVVAFLNELPKTHHDVNSFVV
DISAQTSTLLCFSVNGVFKEVDGKSRDSLRAFTRTFIAVPASNSGLCIVNDELFVRNASP
EEIQRAFAMPAPTPSSSPVPTLSQEQQDMLQAFSTQSGMNLEWSQKCLQDNNWDYTRSAQ
AFTHLKAKGEIPEVAFMK
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaagggaagtcatacaacgaacatgatgaccgtgttagtttcccacaaaga
agaaagaaaggtcgggggcctttccgatggaagtgtggtgtggggaatcgtaggtctgga
agaggtggttctggtatacggtcttcccggtttgaggaagatgatggagatgtggcaatg
aatgatccccaggatggcccccgagtgagattcaacccctataccacccgacctaaccgt
cggagagatacttggcatgatcgagatcggattcatgttactgtacggagagacagagct
cctcaagaaagaggaggtgctggcaccagtcaagatgggaccaccaagaactggttcaag
attacaattccttatggcaaaaagtatgataaaatgtggcttctgagcatgattcaaagc
aagtgcagtgtccccttcaaccccattgagtttcactatgaaaatacacgggcccatttt
tttgtggaaaatgccactaccgcttctgcattaaaggctgtcaactataagattcaggat
cgagaaaacggaaggatatctatcatcatcaactcttctgctccaccctatattgtacag
aatgaactgaagcctgaacaagtagagcagctcaagctgatcatgagcaaacgatatgat
ggctcccagcaagcacttgacctcaagggcctccgctcagacccagatttggtggcccag
aacatcgatgttgttctaaaccgtagaggctgtatggcagccgccctgaggatcattgaa
gagaacattcctgagctattgtctttgaacttgagtaacaacaggctgtacaagcttgat
gacatgtccagcattgtacagaaggcaccaaacttaaagatcctgaatctctctggaaac
gaattgaagtccgagtgggaattagacaagataaaagggctgaagctggaagagctgtgg
cttgacagaaaccccatgtgtgacaccttcctagaccagtccacctatatcagcaccatt
cgcgaacgatttcccaagttattacgcctggatggccatgagctaccccctccaattgcc
tttgatgtcgaagcccctactatgttaccaccctgcaagggaagctattttggaacagag
aacctaaagagtctggtcctgcacttcttgcagcagtactatgcaatttatgactcagga
gaccgccagggtcttctggatgcctaccatgatggcgcctgttgctcgctaagcactcct
tccaaccctcagaaccctgtccgacacaacttagccaaatacttcaatgacagcagaaat
gtgaagaagattaaagataccaccacgcggttccggctattaaagcatacacgtcttaat
gtcgttgccttcctcaatgagttacctaaaactcaccatgacgttaactcctttgtggta
gatataagtgcccaaacaagcacattgttgtgtttttctgtcaatggagtcttcaaggaa
gtggacgggaagtctcgagattctttacgtgctttcacgagaacgttcattgctgttcct
gccagcaattcagggctatgtattgtaaatgacgaattatttgtgcggaacgccagccct
gaagaaatccaaagagccttcgccatgcctgcacccacaccttcttccagcccagtaccc
acactctcccaagaacagcaggatatgttacaagcattttctacccagtctggcatgaac
ctcgagtggtctcagaagtgccttcaagacaataactgggactacaccagatctgcccag
gccttcactcatctcaaggccaagggagagattccagaagtagcgtttatgaaatga

DBGET integrated database retrieval system