KEGG   Rattus norvegicus (rat): 59106Help
Entry
59106             CDS       T01003                                 

Gene name
Ltbp2
Definition
(RefSeq) latent transforming growth factor beta binding protein 2
  KO
K08023  latent transforming growth factor beta binding protein 2/3/4
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99995 Signaling proteins
    59106 (Ltbp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF_CA cEGF TB EGF hEGF FXa_inhibition EGF_3
Motif
Other DBs
NCBI-GeneID: 59106
NCBI-ProteinID: NP_067597
RGD: 68380
Ensembl: ENSRNOG00000012094
UniProt: O35806
Position
6q31
AA seq 1787 aa AA seqDB search
MESTSLRGLRCPQLCSHSGAMRAPTTVRCSGRIQRARWRGFLPLVLALLMGTSHAQRDSV
GRYEPASRDANRLWRPVGNHPAAAAAKVYSLFREPDAPVPGLSPSEWNQPGQGIPGRLAE
AEARRPSRAQQLRRVQSPVQTRRSNPRGQQPPAARTAHSVVRLATPQRPAAARRGRLTGR
NVCGGQCCPGWTTSNSTNHCIKPVCQPPCQNRGSCSRPQLCICRSGFRGARCEEVIPEEE
FDPQNARPVPRRSVEGAPGPHRSSEARGSLVTRIQPLLPPLPPPPSRTLSQTRPLQQHAG
LSRTVRRYPATGTNGQLMSNALPSGPGPELRDSSQQAAHMNHLSHPWGLNLTEKIKKIKV
VFTPTICKQTCARGRCANTCEKGDTTTLYSQGGHGHDPKSGFRIYFCQIPCLNGGRCIGR
DECWCPANSTGKFCHLPVPQPDREPPGRGSQHRALLEGPLKQSTFTLPLSNQLASVNPSL
VKVQMQHPPEASVQIHQVARVRGEVDPVPEDNSVETRASHRPHGSSGHSHWASNSIPARA
GEAPRPPPVPSRHYGLLGQCYLSTVNGQCANPLGELTSQEDCCGSVGTSWGVTSCAPCPP
RPAFPVIENGQLECPQGYKRLNLSHCQDINECLTLGLCKDSECVNTRGSYLCTCRPGLML
DPSRSRCVSDKAVSMKQGLCYRSMVSGTCTLPLVQRITKQICCCSRVGKAWGSKCEHCPL
PGTEAFREICPAGHGYAYSSSDIRLSMRKAEEEELASPVREQRQQSSGPPPGAAERQPLR
AATATWIEAETLPDKGDSRAIQITTSAPHLPARVPGDATGRPTPSLPGQGIPEGPAEEQV
IPSSDVLVTHGPPGFDPCFAGASNICGPGTCVKLPNGYRCVCSPGYQLHPSQDYCTDDNE
CLRNPCEGRGRCVNSVGSYSCLCYPGYTLATLGDTQECQDVDECEQPGVCSGGRCSNTEG
SYHCECDQGYVMVRRGHCQDINECRHPGTCPDGRCVNSPGSYTCLACEEGYIGQSGNCVD
MNECLTPGICAHGRCINMEGSFRCSCEPGYELTPDKKGCRDVDECASRASCPTGLCLNTE
GSFTCSACQSGYWVNEDGTACEDLDECAFPGVCPTGVCTNTVGSFSCKDCDRGFRPSPLG
NSCEDVDECEGPQNSCLGGECKNTDGSYQCLCPQGFQLANGTVCEDVDECVGEEHCAPHG
ECLNSPGSFFCLCAPGFASAEGGTRCQDVDECATTEPCLGGHCVNTEGSFNCLCETGFQP
APDSGECVDIDECANDTVCGNHGFCDNTDGSFRCLCDQGFETSPSGWECVDVNECELMLA
VCGDALCENVEGSFLCLCASDLEEYDAEEGHCRPRVAGAQRIPEVPTEEQAAGLTGMECY
AEHNGGPPCSQILGQNSTQAECCSTQGARWGETCDPCPSEDSVEFSELCPSGQGYIPVEG
AWTFGQAMYTDADECILFGPALCQNGRCLNTVPGYICLCNPGYHYDAVSRKCQDHNECQD
LACENGECVNTEGSFHCFCSPPLILDLSGQRCVNSTSSSEDFPDHDIHMDICWKKVTNDV
CSQPLRGHHTTYTECCCQDGEAWSQQCALCPPRSSEVYAQLCNVARIEAEREAGIHFRPG
YEYGPGPDDLPETLYGPDGAPFYNYLGPEDTVPEPPFSNTASHLGDNTPILEPPLQPSEL
QPHYIPSHSEPLASFEGLQAEECGILNGCENGRCVRVREGYTCDCFEGFQLDTALMACVD
VNECEDLNGPAALCAHGHCENTEGSYRCHCSPGYVAEPGPPHCAAKE
NT seq 5364 nt NT seq  +upstreamnt  +downstreamnt
atggagagcacctccctgcgaggtctccggtgcccacagctctgcagccactctggcgcc
atgagggcgccgaccaccgtccgctgctccggacgcatccaaagggcgcgttggaggggc
ttcctgccacttgtcctggctctcttgatggggacaagtcatgcccaaagggattccgtg
gggagatacgaaccagctagccgggatgccaatcggttgtggcgccccgtgggcaaccac
cccgcagcggctgcagccaaggtgtacagtctgttccgagagcccgacgcgccggtcccc
ggcttgtcgccctctgagtggaatcagccgggccaggggatccctgggaggctcgcagag
gccgaggccaggagaccgtcccgagcccagcagctgcgtcgagtccagtcacctgtccag
actcggagaagcaatccccgaggccagcagccaccagcagcccggaccgcacattccgtc
gtgcgcctggcgacccctcagcgacccgcggctgcacgccgagggcggctcaccgggaga
aatgtctgcgggggacagtgctgccctggatggacgacatcgaacagcaccaaccactgt
atcaaacctgtgtgtcagcctccctgtcagaaccggggctcctgcagccggccccagctc
tgcatctgccgttctggcttccgtggggcacgctgcgaggaggtcatccctgaggaggag
tttgaccctcagaatgccaggcctgtgcccagacgctcagtggagggagcacctggccct
cacaggagcagcgaggccagaggaagtctagtgaccagaatacagccgctgctaccacca
ctaccaccacctccatctaggaccctcagccagacccgtcccctgcagcagcatgcagga
ctgtccagaacagttcgtcgttatccggccactggtaccaatggccaactgatgtccaac
gctctgccttcaggaccaggacctgagctgagagacagcagccaacaggcagcacacatg
aaccatctctcacacccctgggggctgaacctcaccgagaaaatcaagaagattaaggtc
gtcttcactcccaccatctgcaagcagacctgtgcccggggccgctgtgccaacacgtgt
gagaagggtgacaccaccaccctgtacagtcagggcggccatgggcatgaccccaagtct
ggcttccgtatctatttctgccaaatcccctgcctgaatggaggccgctgcattggccgg
gacgagtgctggtgtccagccaactctacagggaagttctgccatctgcctgtcccacag
ccagacagggagcctccaggacgaggctcccagcacagagccctgctggaagggccattg
aagcaatccaccttcacgctgcctctctccaaccagctggcctctgtgaacccctcgctg
gtgaaggtacaaatgcagcacccgcctgaggcctccgtgcagatccaccaggtggcccgg
gtccggggtgaggtggaccctgtgccagaggacaacagtgtggagaccagagcctctcat
cgcccccatggcagctcaggccacagccactgggccagcaacagcatacccgctcgggct
ggagaggcccctcggccaccaccagtgccgtccaggcattatggacttctgggccagtgt
tacctgagcacggtgaatggacagtgtgctaaccccctaggggagctgacttctcaggaa
gactgctgtggcagtgtggggacttcttggggggtgacttcctgtgccccatgcccaccc
agaccagctttccccgtgattgaaaacggccagctggagtgtccccaagggtataagaga
ctaaacctcagccattgccaagacatcaatgagtgcctgaccctgggcctgtgcaaggat
tcagagtgtgtgaacaccaggggcagctacctgtgcacctgcaggcccggcctcatgctg
gatccatcaaggagccgctgtgtatcggacaaggctgtctccatgaaacagggactctgt
taccggtcaatggtgtctggcacctgcaccctgcctttggtacaacggatcaccaagcag
atatgctgttgcagccgtgtgggcaaagcctggggcagcaaatgtgaacactgccccctg
cctggcacagaagccttcagggagatctgccctgctggccatggctacgcctactcaagc
tcagacatccgcctgtctatgaggaaagctgaggaagaggaactggctagccccgtaagg
gaacagagacagcagagcagtggacccccacctggggcagcagaaaggcagccactccgg
gcagccactgccacctggattgaggctgagaccctccctgacaaaggtgactctcgggct
attcagattacaaccagtgctccccacctacctgcccgggtaccaggggatgccactgga
agaccaacgccatcattgcctggacagggcattccagagggtccagcagaagagcaggtg
atcccttccagtgatgtcctggtgacgcacggtcccccaggctttgatccatgtttcgct
ggagcctccaacatctgtggccctgggacctgtgtgaagctcccaaatggatacagatgt
gtctgcagccctggttaccagctacaccccagccaggactactgtactgatgacaacgag
tgtctgaggaacccctgtgaaggaagagggcgctgtgtcaacagtgtgggctcctactcc
tgcctctgctacccaggctacacactagccaccctaggagacacacaggagtgccaagat
gtggatgagtgtgagcagccgggggtgtgcagcggtggacgatgcagcaacactgagggc
tcgtaccactgcgagtgtgatcagggctacgtcatggtcagaagaggacactgccaagat
atcaacgaatgccgtcaccctggtacctgccctgatgggagatgcgtcaactcccctggc
tcctacacttgtctggcctgtgaggagggctacatagggcagagcgggaactgtgtagat
atgaatgagtgtctgacccccgggatatgtgcccatggaaggtgcatcaacatggaaggc
tcctttagatgctcttgtgagccaggctatgagctcaccccagacaagaagggctgccga
gatgtggacgagtgtgccagccgagcctcatgccccaccggcctctgcctcaacacggag
ggctccttcacctgctcagcctgtcagagtgggtactgggtgaacgaagatggcactgcc
tgtgaagacctggatgaatgtgccttccccggagtctgccccacaggcgtctgcaccaac
actgtgggctccttctcctgcaaggactgcgacaggggcttccggcccagccccctgggc
aacagctgtgaagatgtggatgagtgtgaaggtccccagaacagctgcctgggaggcgag
tgcaagaacacagatggttcctaccagtgcctctgtccccagggcttccagctggccaat
ggcaccgtgtgtgaggatgtggacgaatgtgttggggaagaacactgcgctcctcatggc
gaatgcctcaacagcccggggtccttcttctgtctctgtgcacccggctttgctagtgct
gaggggggcaccagatgccaggatgttgatgaatgtgcaaccacagagccgtgtctggga
ggacactgtgtcaacaccgagggctccttcaactgtctgtgtgagactggcttccagccc
gccccagacagtggagagtgtgtggacatagatgaatgtgcaaatgatactgtgtgtggg
aaccatggcttctgtgacaatacggatggctccttccgctgcctgtgtgaccagggcttc
gagacctcaccctcaggctgggagtgtgttgatgtgaacgagtgtgagctcatgctggca
gtgtgtggggatgcactctgcgagaacgtggaaggctccttcctgtgcctttgtgccagt
gaccttgaggagtatgatgcagaagaaggacactgccgtcctcgggtggctggagctcag
agaatcccagaggtcccaacagaggagcaggctgcaggccttaccggcatggagtgctat
gctgaacacaatggtggtcctccatgctctcaaatcttgggccagaactccacacaggct
gagtgctgctcgacccagggtgccagatggggggaaacctgtgatccctgcccatctgag
gactcagttgaattcagtgagctgtgccccagtggtcaaggttacatcccagtggaaggg
gcctggacatttggacaagccatgtatacagatgccgacgagtgcatactgtttgggcct
gctctctgccagaatggccgatgcctcaacacagtgcctggctacatttgcctgtgcaac
cctggctaccactatgatgccgtcagcaggaagtgccaggatcacaacgaatgccaggac
ttggcctgtgagaacggcgagtgtgtgaacacagaaggctccttccactgcttctgcagt
ccccccctcatcctagacctcagcggacagcgctgtgtgaacagtaccagcagctcagag
gacttccctgaccatgacatccacatggacatctgctggaaaaaagtcaccaatgacgtg
tgcagccagcccttgcgtgggcaccatactacctatacagagtgctgctgccaagacggg
gaggcctggagccagcagtgtgctctgtgcccccccaggagctctgaggtctatgctcag
ctgtgcaatgtggctcggattgaggcagagagggaagcagggatccacttccggccagga
tatgagtatggccctggcccagatgatctacctgaaaccctctacggcccagatggagcc
cctttctataactacctgggccctgaggacactgttcctgagcctcccttctccaacaca
gccagtcatttgggagacaacacacccatccttgagcctcctctgcagccctctgaactt
cagccccactatatccccagccattcagaacccctggcttccttcgaaggccttcaggct
gaggaatgtggcatcctgaatggctgtgagaatggccgctgtgtgcgtgtgcgcgagggc
tacacttgtgactgctttgaaggcttccagctggatacagccctcatggcctgtgtggat
gtgaatgagtgtgaagacctgaacgggcctgcggcactctgtgcgcatggtcactgcgag
aacacagagggttcctatcgctgccactgttcccctggttacgtggcagagcccgggccc
ccacactgtgcagccaaggagtag

DBGET integrated database retrieval system