KEGG   Rattus norvegicus (rat): 59108Help
Entry
59108             CDS       T01003                                 

Gene name
Mb, Glng
Definition
(RefSeq) myoglobin
  KO
K21892  myoglobin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    59108 (Mb)
Transporters [BR:rno02000]
 Other Transporters
  Pores ion channels [TC:1]
   59108 (Mb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin LpxI_N Sulfotransfer_2
Motif
Other DBs
NCBI-GeneID: 59108
NCBI-ProteinID: NP_067599
RGD: 620411
Ensembl: ENSRNOG00000004583
UniProt: Q9QZ76 A0A1K0FUB2
Position
7q34
AA seq 154 aa AA seqDB search
MGLSDGEWQMVLNIWGKVEGDLAGHGQEVLISLFKAHPETLEKFDKFKNLKSEEEMKSSE
DLKKHGCTVLTALGTILKKKGQHAAEIQPLAQSHATKHKIPVKYLEFISEVIIQVLKKRY
SGDFGADAQGAMSKALELFRNDIAAKYKELGFQG
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggggctcagtgatggggagtggcagatggtgctgaacatctgggggaaagtggagggc
gaccttgctggccatggacaggaagtcctcatcagtctatttaaggctcaccccgagacc
ctggaaaagttcgacaagttcaagaacctgaaatccgaggaagagatgaagagttcagag
gacctgaagaagcacggctgcaccgtgctcacagccctgggtaccatcctgaagaagaag
ggacaacatgctgctgagatccagcctctggcccagtcccacgccaccaagcacaagatc
ccggtcaagtacctggagtttatctcagaagtcatcatccaagtcctgaagaagagatat
tccggggactttggagcagatgctcagggcgccatgagcaaggccctggagctgttccgg
aatgacattgctgccaagtacaaggagctgggcttccagggctga

DBGET integrated database retrieval system