KEGG   Rattus norvegicus (rat): 59112Help
Entry
59112             CDS       T01003                                 

Gene name
Hand1, eHand
Definition
(RefSeq) heart and neural crest derivatives expressed 1
  KO
K09071  heart-and neural crest derivatives-expressed protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    59112 (Hand1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    59112 (Hand1)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Mesodermal Twist-like factors
    59112 (Hand1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH HTH_51
Motif
Other DBs
NCBI-GeneID: 59112
NCBI-ProteinID: NP_067603
RGD: 621206
Ensembl: ENSRNOG00000002582
UniProt: P97832
Position
10q22
AA seq 216 aa AA seqDB search
MNLVGSYAHHHHHHHSHPPHPMLHEPFLFGPASRCHQERPYFQSWLLSPADAAPDFPAGG
PPPTTAVAAAAYGPDARPSQSPGRLEALGGRLPRRKGSGPKKERRRTESINSAFAELREC
IPNVPADTKLSKIKTLRLATSYIAYLMDVLAKDAQAGDPEAFKAELKKTDGGRESKRKRE
SPQQHEGLPPALGPSEKRIKGRTGWPQQVWALELNQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcgtgggcagctacgcacaccatcaccaccatcaccactcacacccgccgcac
cccatgctgcacgaacccttcctctttggtccggcctcgcgttgccaccaggagcggcct
tacttccagagctggctgctgagcccggctgatgctgccccagatttccctgccggcggg
ccaccacctaccaccgcagtagcagcggctgcctatggtcccgatgccaggccgagtcag
agcccaggtcggctggaggctcttggaggccgcctgcccaggcgaaaaggttcaggaccc
aaaaaggagcggaggcgcacagagagcattaacagtgcgttcgcggagctgcgtgagtgc
atccccaatgtgcctgcggacaccaagctctccaagatcaagactctgcgcctggccacc
agctacatcgcctacttgatggacgtgctggccaaggatgcacaagcaggtgaccccgag
gccttcaaggctgaactaaaaaagacggatggcggtcgcgaaagcaagcggaaaagggag
tcgcctcagcagcacgaaggccttcctcctgccctggggccaagcgagaagaggattaaa
ggacgcactggctggcctcagcaagtctgggcgctggagctaaatcagtga

DBGET integrated database retrieval system