KEGG   Rattus norvegicus (rat): 59113Help
Entry
59113             CDS       T01003                                 

Gene name
Kmo
Definition
(RefSeq) kynurenine 3-monooxygenase
  KO
K00486  kynurenine 3-monooxygenase [EC:1.14.13.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno00380  Tryptophan metabolism
rno01100  Metabolic pathways
Module
rno_M00038  Tryptophan metabolism, tryptophan => kynurenine => 2-aminomuconate
Brite
KEGG Orthology (KO) [BR:rno00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    59113 (Kmo)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.9  kynurenine 3-monooxygenase
     59113 (Kmo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_3 NAD_binding_8 DAO SE Pyr_redox Pyr_redox_2 NAD_binding_7 3HCDH_N FAD_binding_2 HI0933_like
Motif
Other DBs
NCBI-GeneID: 59113
NCBI-ProteinID: NP_067604
RGD: 620610
Ensembl: ENSRNOG00000003709
UniProt: O88867
Position
13q25
AA seq 478 aa AA seqDB search
MASSDTEGKRVVVIGGGLVGALNACFLAKRNFQVDVYEAREDIRVANFMRGRSINLALSY
RGRQALKAVGLEDQIVSKGVPMKARMIHSLSGKKSAIPYGNKSQYILSISREKLNKDLLT
AVESYPNAKVHFGHKLSKCCPEEGILTMLGPNKVPRDITCDLIVGCDGAYSTVRAHLMKK
PRFDYSQQYIPHGYMELTIPPKNGEYAMEPNCLHIWPRNAFMMIALPNMDKSFTCTLFMS
FEEFEKLPTHSDVLDFFQKNFPDAIPLMGEQALMRDFFLLPAQPMISVKCSPFHLKSRCV
LMGDAAHAIVPFFGQGMNAGFEDCLVFDELMDKFNNDLSVCLPEFSRFRIPDDHAISDLS
MYNYIEMRAHVNSRWFLFQRLLDKFLHALMPSTFIPLYTMVAFTRIRYHEAVLRWHWQKK
VINRGLFVLGSLVAIGSAYILVHHLSPRPLELLRSAWTGTSGHWNRSADISPRVPWSH
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcatcgtcggacactgaaggaaaaagagtggttgttatcggtggtggtttggttgga
gcattgaacgcgtgctttctcgcaaagaggaatttccaagttgatgtgtacgaagctagg
gaagatattcgagtggctaactttatgcgtggaagaagcattaatttggccctttcttat
agaggacggcaggccttgaaggccgttggtctggaagatcagatcgtgtccaaaggtgtg
cccatgaaagccagaatgatccactctctctcgggaaagaagtctgcaattccctatggg
aacaagtcacagtatatcctttcaataagcagagaaaagttaaacaaggatctgctgact
gccgtggagtcctaccccaatgcaaaggtgcactttggccacaagctgtcaaaatgctgt
ccggaggaagggatactcacgatgcttggacccaacaaagttcccagagacatcacgtgt
gacctcattgtaggatgtgatggggcctactcaactgtcagagctcacctcatgaagaag
ccccgttttgattacagtcagcaatatatccctcatggctatatggagctgacaattcca
cctaagaacggggagtatgccatggaacctaactgtcttcacatttggcctagaaatgcc
tttatgatgatcgccctaccgaacatggacaaatctttcacatgcaccttgttcatgtcc
tttgaggagtttgaaaagcttccaacgcatagtgatgtgctggacttcttccagaagaac
tttccagatgccatccctctgatgggcgagcaagccctcatgagagatttctttctgttg
cctgcccagcccatgatatcagtaaagtgctctcccttccacctgaagtcacgctgtgtg
ctgatgggagatgcagctcatgccatcgtcccattttttgggcaaggaatgaatgcgggc
tttgaagactgcttggtatttgatgagttaatggacaaattcaataatgatcttagtgtg
tgccttcctgaattctcaagatttaggattcctgatgaccatgcaatttcagacctgtct
atgtacaattacatagagatgcgagcgcatgtcaactctaggtggttcctgtttcaaagg
ctcctggataaatttcttcatgcactaatgccatccactttcatccctctctataccatg
gtcgccttcaccagaataagataccacgaggcagtgctgcgctggcattggcaaaaaaag
gtgataaacagaggactctttgtccttgggtccctggtagccattggaagtgcctacata
ctcgtgcaccacctgtccccgagacctctggaactcctgagatctgcctggacgggaacc
tctggccactggaataggagtgcagacatttctccacgagttccatggagtcactag

DBGET integrated database retrieval system