KEGG   Rattus norvegicus (rat): 59114Help
Entry
59114             CDS       T01003                                 

Gene name
Slc9a3r1
Definition
(RefSeq) SLC9A3 regulator 1
  KO
K13365  Na(+)/H(+) exchange regulatory cofactor NHE-RF1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04530  Tight junction
rno04928  Parathyroid hormone synthesis, secretion and action
rno05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    59114 (Slc9a3r1)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    59114 (Slc9a3r1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    59114 (Slc9a3r1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    59114 (Slc9a3r1)
Transporters [BR:rno02000]
 Other Transporters
  Accessory factors involved in transport [TC:8]
   59114 (Slc9a3r1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EBP50_C PDZ PDZ_2 GRASP55_65 Tricorn_PDZ DUF4424 PHA_synth_III_E Phasin
Motif
Other DBs
NCBI-GeneID: 59114
NCBI-ProteinID: NP_067605
RGD: 708538
Ensembl: ENSRNOG00000003232
UniProt: Q9JJ19
Position
10q32.1
AA seq 356 aa AA seqDB search
MSADAAAGEPLPRLCCLEKGPNGYGFHLHGEKGKVGQFIRLVEPGSPAEKSGLLAGDRLV
EVNGENVEKETHQQVVSRIRAALNAVRLLVVDPETDEQLKKLGVPIREELLRAQEKSEHT
EPPAAADTKKAGDQNEAEKSHLERCELRPRLCTMKKGPNGYGFNLHSDKSKPGQFIRAVD
PDSPAEASGLRAQDRIVEVNGVCMEGKQHGDVVSAIKAGGDEAKLLVVDKETDEFFKKCR
VTPSQEHLDGPLPEPFSNGEIQKENSREALVEPASESPRPALARSASSDTSEELNAQDSP
KRHDSTEPSSTSSSSDPILDFNISLAVAKERAHQKRSSKRAPQMDWSKKNELFSNL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcggacgcagcggccggggagcctctgccccggctctgctgcctcgagaagggt
ccgaacggctacggcttccacctgcacggggagaaaggcaaggtgggccagtttattcgg
ctagtggagcctggctcgccggccgagaagtcggggttgctggccggggaccgattggtg
gaggtgaacggtgagaatgtggagaaggagacgcatcagcaggtggtgagccgcatccgc
gcggcgctgaacgccgtgcgcctgctggtggtcgaccctgagaccgacgagcaactcaag
aagctgggcgtcccgatccgggaagagctgctgcgcgcccaggagaagtccgagcacacc
gagccgccagcggccgccgacactaagaaggctggggaccagaatgaggccgaaaagagc
cacttggagcggtgtgagctccgaccccggctctgcaccatgaagaaaggccccaatggt
tatggcttcaacctgcacagtgacaaatccaagccaggccagttcatccgagcagtggac
ccggactcaccagcagaggcgtctggcctccgggcccaggaccggattgtggaggtcaat
ggcgtctgcatggagggcaaacagcacggggacgtcgtgtctgccatcaaggctggaggt
gatgaagccaagctgctggtggtagacaaggaaacagatgagttctttaagaagtgcaga
gtgaccccgtcccaggagcacctggatggccccttgcctgaacccttcagcaatggagag
atacagaaggagaacagccgtgaagccctggtagagccagcttcagaaagccccaggcca
gccctggcaagatctgcctccagcgataccagtgaggagctaaatgcccaagatagtccc
aagagacacgattccacagagccctcatctacctcctcctcctctgaccccatcttggac
ttcaacatctccctggctgtggctaaagagagggcccaccagaagcgcagtagcaagcgg
gccccgcagatggactggagcaagaaaaatgaactcttcagcaacctctga

DBGET integrated database retrieval system