KEGG   Rattus norvegicus (rat): 59264Help
Entry
59264             CDS       T01003                                 

Gene name
Ltb4r, Ltb4r1
Definition
(RefSeq) leukotriene B4 receptor
  KO
K04296  leukotriene B4 receptor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    59264 (Ltb4r)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    59264 (Ltb4r)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Lipid
   Leukotriene
    59264 (Ltb4r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx Serpentine_r_xa 7tm_4
Motif
Other DBs
NCBI-GeneID: 59264
NCBI-ProteinID: NP_067688
RGD: 620410
Ensembl: ENSRNOG00000020399
UniProt: Q9R0Q2
Position
15p13
AA seq 351 aa AA seqDB search
MAANTTSTAATSSPGGMSLSLLPIVLLSVALVVGLPGNSFVVWSILKRMQKRSVTALLVL
NLALADLAVLLTAPFFLHFLARGTWSFEVTGCRLCHYVCGVSMYASVLLITIMSLDRSLA
VARPFVSQKVRTKAFARWVLAGIWVVSFLLAIPVLVYRTVTPKNKTLICDSRYPSDGHKV
FHLLFEAITGFLLPFLAVVASYSDIGRRLQARRFRRSRRTGRLVVLIILAFAAFWLPYHL
VNLVEAGRTLAGWDKNSPAGQRLKLARYVLIALAFLSSSVNPVLYACAGGGLLRSAGVGF
VVKLLEGTGSEVSSTRRGGTLVQTPKATPTCPEPGPTDSFMTSSTPPESSK
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaacactacatctactgcagcaacttcttctcctggtggcatgtccctgtct
ctgttgcccattgtcctgctgtctgtggccctggttgtggggcttcccggcaatagcttt
gtcgtgtggagcatcctgaaaaggatgcagaaacgctctgtcaccgccctgctggtgctg
aacttggccctggccgacctggccgtgttgctcactgctccctttttcctacactttctg
gctcggggcacctggagttttgaagtgaccggttgccgcctgtgtcactatgtctgtgga
gtaagcatgtatgccagcgtcctgcttatcactatcatgagcctggaccgctcactggca
gttgcccgcccctttgtgtcccaaaaggttcgtactaaagcctttgcccgatgggtgctg
gcaggtatctgggtggtgtcttttctgctggccataccggtccttgtgtaccgcacagta
acacccaagaacaagacgttgatctgcgactcgaggtatcccagcgacgggcataaagtc
tttcatctgctctttgaagccatcacgggcttcctgctgcccttcctggcggtggtggcc
agctactctgacatcgggcgcaggctgcaggctcggcgcttccgccgcagccgccgcacc
ggtcgcctggtggtgctcattatcctggccttcgccgccttctggctgccttatcacctg
gtgaacctggtggaagctggccgcacgctggccggctgggacaagaacagccctgctggg
cagcgtctgaagctggcccgctacgtgctgatcgcgctggccttcctgagcagcagcgtg
aacccggtgctgtacgcgtgcgcaggcggcggcctgcttcgttcggcgggcgtgggcttc
gtagtcaagctgctcgagggcactggctccgaggtgtccagcacccgtcgcggaggcact
ttggtccagaccccgaaggccacacccacctgtcctgaaccgggccccaccgacagcttc
atgacttcctccacccctcctgaatcttcgaagtga

DBGET integrated database retrieval system