KEGG   Rattus norvegicus (rat): 59266Help
Entry
59266             CDS       T01003                                 

Gene name
Hcn4
Definition
(RefSeq) hyperpolarization activated cyclic nucleotide-gated potassium channel 4
  KO
K04957  hyperpolarization activated cyclic nucleotide-gated potassium channel 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04742  Taste transduction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    59266 (Hcn4)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    59266 (Hcn4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    59266 (Hcn4)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Cyclic nucleotide-gated channel (HCN)
   59266 (Hcn4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ion_trans_N cNMP_binding Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 59266
NCBI-ProteinID: NP_067690
RGD: 71065
Ensembl: ENSRNOG00000009450
UniProt: Q9JKA7
Position
8q24
AA seq 1198 aa AA seqDB search
MDKLPPSMRKRLYSLPQQVGAKAWIMDEEEDGEEEGAGGLQDPSRRSIRLRPLPSPSPSV
AAGCSESRGAALGAADSEGPGRSAGKSSTNGDCRRFRGSLASLGSRGGGSGGAGGGSSLG
HLHDSAEERRLIAAEGDASPGEDRTPPGLATEPERPGAAAQPAASPPPQQPPQPASASCE
QPSADTAIKVEGGAAASDQILPEAEVRLGQSGFMQRQFGAMLQPGVNKFSLRMFGSQKAV
EREQERVKSAGFWIIHPYSDFRFYWDLTMLLLMVGNLIIIPVGITFFKDENTTPWIVFNV
VSDTFFLIDLVLNFRTGIVVEDNTEIILDPQRIKMKYLKSWFVVDFISSIPVDYIFLIVE
TRIDSEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHMTYDLASAVVRIVN
LIGMMLLLCHWDGCLQFLVPMLQDFPHDCWVSINGMVNNSWGKQYSYALFKAMSHMLCIG
YGRQAPVGMSDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQYQEKYKQVEQYMSF
HKLPPDTRQRIHDYYEHRYQGKMFDEESILGELSEPLREEIINFNCRKLVASMPLFANAD
PNFVTSMLTKLRFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKETKLADGSYFGE
ICLLTRGRRTASVRADTYCRLYSLSVDNFNEVLEEYPMMRRAFETVALDRLDRIGKKNSI
LLHKVQHDLNSGVFNYQENEIIQQIVRHDREMAHCAHRVQAAASATPTPTPVIWTPLIQA
PLQAAAATTSVAIALTHHPRLPAAIFRPPPGPGLGNLGAGQTPRHPRRLQSLIPSALGSA
SPASSPSQVDTPSSSSFHIQQLAGFSAPPGLSPLLPSSSSSPPPGACSSPPAPTPSTSTA
ATTTGFGHFHKALGGSLSSSDSPLLTPLQPGARSPQAAQPPPPLPGARGGLGLLEHFLPP
PPSSRSPSSSPGQLGQPPGELSPGLAAGPPSTPETPPRPERPSFMAGASGGASPVAFTPR
GGLSPPGHSPGPPRTFPSAPPRASGSHGSLLLPPASSPPPPQVPQRRGTPPLTPGRLTQD
LKLISASQPALPQDGAQTLRRASPHSSGESMAAFSLYPRAGGGSGSSGGLGPPGRPYGAI
PGQHVTLPRKTSSGSLPPPLSLFGARAASSGGPPLTAAPQREPGARSEPVRSKLPSNL
NT seq 3597 nt NT seq  +upstreamnt  +downstreamnt
atggacaagctgccgccgtccatgcgcaagcggctctacagccttccgcagcaggtgggg
gccaaggcgtggatcatggacgaggaagaggatggtgaggaagagggggccgggggcctc
caggacccaagccgaaggagcattcggctgcggccgctgccctcgccctcgccctcggtg
gccgccggctgctccgagtcccggggtgcggccctcggggcggcagacagcgaggggccg
ggccgcagcgccggcaagtccagcaccaacggtgactgcaggcgcttccgcgggagtctg
gcctcgctgggcagccggggcggcggcagtggtggagcagggggcggcagcagtctcggg
cacctgcatgactccgcggaggagcggcggctcatcgccgctgagggcgatgcgtccccc
ggcgaggacaggacgcccccgggcctggcgaccgagcccgagcgcccgggcgccgcggca
caacccgcagcctcgccgccgccccaacagccgccgcagccggcctccgcctcctgcgag
cagccctcggcggacacagctatcaaagtggaaggaggcgcggccgccagcgaccagatc
ctccctgaggccgaggtgcgcctgggccagagcggcttcatgcagcgccagttcggtgcc
atgctgcaacctggggtcaacaaattctcgctaaggatgttcggcagccagaaagcagtg
gagcgtgagcaggagagggttaagtcagctgggttttggattatccacccctacagcgac
ttcagattttactgggacctgacgatgctgttgctgatggtggggaatctgatcatcatc
cctgtgggcatcaccttcttcaaggatgagaacaccaccccctggatcgtcttcaacgtg
gtgtcagacacattcttcctcattgacttggtcctcaacttccgcacggggatcgtggtg
gaggacaacacagaaatcatccttgacccacagcggatcaagatgaagtacctgaaaagc
tggtttgtggtggacttcatctcctccatccccgtggactacatcttccttatagtggag
actcgcattgactcggaggtctacaaaaccgccagggctctgcgcattgtccgcttcacg
aagatcctcagcctcctgcgcctcctgcggctttcccgcctcattcggtacattcaccag
tgggaagagatcttccacatgacctacgacctggccagtgccgtggtacgcatcgtgaac
ctcattggcatgatgcttctgctttgccactgggatggctgcctgcagttcctggtgccc
atgctgcaggacttcccccatgactgctgggtgtccatcaacggcatggtgaataactcc
tgggggaagcagtactcctatgccctcttcaaggccatgagccacatgctgtgtattggg
tacggacggcaggcacccgtaggcatgtctgacgtctggctcaccatgctcagcatgatc
gtgggcgccacctgctatgccatgttcatcgggcacgccactgccctcatccagtcgctg
gactcctcccggcgccagtaccaggagaagtacaagcaggtggagcagtacatgtccttc
cacaagctcccgcctgacaccaggcagcgcatccacgactactacgaacaccgctaccag
ggcaagatgtttgacgaggaaagcatcctgggtgagctgagtgagccgcttcgagaggag
atcatcaactttaactgccggaagctggtggcatccatgccactgttcgccaatgcagac
cccaactttgtgacgtctatgctgaccaagttgcgttttgaggtctttcagcctggggac
tacatcatccgtgaaggcaccatcggcaagaagatgtactttatccagcacggcgtggtc
agtgtgctcactaagggcaacaaggagaccaagctggctgatggctcctattttggagag
atctgcttgctgacccgaggccgtcgcacagcgagcgtgagggcggatacttactgccgc
ctctactcactgagcgtggacaacttcaacgaggtgctggaggagtatcccatgatgcgc
agggctttcgagacggttgcgctggaccgtctggaccgcataggcaagaagaactccatc
ctcctccacaaggtgcagcacgacctcaactcaggcgtcttcaactaccaagagaacgag
atcatccagcagatcgtgcggcatgaccgtgagatggcccactgtgctcaccgcgtccag
gctgctgcctcagccaccccaaccccaacgcctgtcatatggaccccactgatccaggca
ccactgcaggctgctgctgctactacttcggtggccatagccctcacacaccacccccgc
ctgccagccgctatcttccggccccctcccggacctgggctgggtaacctgggggctgga
cagacaccgaggcacccaaggaggttgcagtccttgatcccttcagcgctaggctctgct
tcaccagccagcagcccctcacaggtggacacaccgtcttcatcttccttccacatccaa
cagctggctggattctctgcacctcctggattgagtcctctcttgccctcctctagctct
tccccacctccaggagcctgcagttctcccccagcccccactccatccacctccactgct
gccaccaccaccgggttcggccactttcataaggcgctaggtggctccctgtcttcctct
gattccccgctgctcaccccactgcaaccgggcgctcgctctccacaggctgcccagccg
ccacccccactgcctggggcccgaggaggcctgggactcctggagcacttcttgccgccc
ccaccttcgtcccggtcaccatcatctagccctgggcagctgggccagcctcctggagag
ttgtccccaggtctggcagctggtccaccaagtacaccagagacacccccgcggcccgaa
cggccatcctttatggcaggggcctctgggggggcttctcctgtagcctttaccccccga
ggaggcctcagccctccgggccacagcccaggacccccaagaactttcccgagtgcccca
ccccgggcctctggctcccatggttccctgctcctgccacctgcatccagccctccgcct
ccccaggtcccacagcgcaggggcacaccacccctcacccccggccgcctcacacaggac
ctgaagctcatctcagcctctcagccagccctcccccaggatggggcacagactctacgc
agggcctctcctcactcctcaggggagtcgatggctgccttctcactctaccccagagct
gggggtggcagtgggagcagtgggggccttgggcctcctggaaggccatatggtgccatc
ccaggccagcatgtcactttgcctcggaagacatcctcaggttctttgccacccccactt
tctttgtttggggcaagagccgcctcttctggagggccccctctgactgctgcaccccag
agggaacctggcgctaggtccgagccagtacgctccaaactgccgtctaatttatga

DBGET integrated database retrieval system