KEGG   Rattus norvegicus (rat): 59299
Entry
59299             CDS       T01003                                 

Gene name
Trdn
Definition
(RefSeq) triadin
  KO
K23449  triadin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04260  Cardiac muscle contraction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    59299 (Trdn)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    59299 (Trdn)
SSDB
Motif
Pfam: Asp-B-Hydro_N
Other DBs
NCBI-GeneID: 59299
NCBI-ProteinID: NP_067698
RGD: 619856
Ensembl: ENSRNOG00000012609
Vega: OTTRNOG00000002416
UniProt: Q9QX75
Position
1p12-p11
AA seq 687 aa
MTEITAEGNASITTTVIDNKNGSVPKSPGKVLKRTVTEDIVTTFSSPAAWLLVIALIITW
SAVAIVMFDLVDYKNFSASSIAKIGSDPLKLVNDAVEETTDWIYGFFSLLSDIISSDGDE
DDEDADEDIDKGEIEEPPLKRKEIQKEKAEKQEKPEKKIQTKVSHREKEKGKEKLKGEKP
EKKATHKEKLEKKERTETKMAAKEDKKIKTKEKTEEKAKKEMKVGKQEKAKPAAAKAKET
PKTTPKAREKDDKETPAVPKHEQKDQYAFCRYMIDMFVHGDLKPGQSPAVPPPSLTASRP
ALSTPSLEEKEKEEKKKVEKKVTSDTKKKEKGEAKKKSEKETVIDGKGKEPGKPPETKQT
TTKLTTQAAATKDEKKEDSKKMKKPPEEKPKGKKQEKKEKHIEPAKTPKKEHPAPSEKHR
KAKAEQAKEEIAPASTKKALHGKKEEKAKTVEQGKDVKPKLPQPQLKKEEKSEPQPKKEV
KLETQLKKEEKSEPQVKKEAKLASSEKGQTRKQNITRPEQVIPHGKPEQKVPKQIKAITA
EKTEKAERQEKYHPSIKTEGKPEVTDSGKKKIEKPEKESKVPPKQENLQVRNVTRAEKRG
KISKDSKDAPAPKKDKDSKDVLHSKKDKEVTNNVSSPKKQKSPISFFQCVYLDGYNGYGF
QFPVTPVQHSGENPGKSNSPGQKQQEQ
NT seq 2064 nt   +upstreamnt  +downstreamnt
atgactgagatcacagctgaaggaaatgcatctataaccacaactgtgatagacaacaaa
aatggatctgttcccaagtcccctggaaaggtgctgaagaggactgtcaccgaagacatc
gtgacaacattcagctcccctgcagcctggcttctggtcatcgccctgattatcacctgg
tcagctgttgctattgtgatgtttgatttagtggactacaaaaacttttcagcaagctcc
atcgccaagattggctctgatcctctaaaactagtgaacgatgctgtggaggaaacaaca
gactggatctatggcttcttctctttgctatctgatatcatctcatctgatggtgatgaa
gatgatgaggatgcagatgaggacattgacaaaggagaaatagaagaacctcccttaaaa
agaaaagaaatacaaaaagagaaggctgaaaagcaggagaaacctgagaagaaaatacaa
actaaagtttcgcacagagaaaaggagaaaggaaaagaaaaattaaaaggagaaaaacct
gagaagaaagcaactcacaaggagaaacttgagaaaaaagaaagaacagagacaaagatg
gcagcaaaagaggacaagaaaattaagactaaggaaaagaccgaagaaaaggctaagaag
gaaatgaaagttgggaaacaggagaaagcgaaaccagcagctgcaaaagccaaagaaact
ccgaaaacaacaccgaaagccagagagaaggatgacaaagaaacgccagctgtgcccaag
catgagcagaaagatcagtatgcgttctgtcgatatatgattgacatgtttgtccatggg
gatttaaaaccaggacaaagcccagctgtgccaccaccatcattgacagcttccagacct
gctttgtcaacaccatcactggaagaaaaagaaaaagaagaaaagaagaaagtggagaag
aaagttacttctgatacaaaaaagaaagaaaaaggagaagccaaaaagaaaagcgagaaa
gaaactgtcattgatgggaaaggaaaagagccaggaaaacctcctgaaacaaaacaaaca
accaccaaactcacaacacaagctgcagctaccaaagatgagaagaaagaagattccaag
aaaatgaaaaaacctccagaagagaaacccaagggaaaaaaacaggaaaagaaagaaaag
cacatagaaccagcaaagacaccaaaaaaggaacatccagctccaagtgaaaaacacaga
aaagcaaaagctgagcaagccaaagaagagattgctcctgcctcaacaaaaaaggccctg
catggaaagaaagaagagaaagccaagacagtggagcaaggcaaagatgtaaagcctaaa
ctaccacagccacaactaaaaaaggaagagaagtccgagccacaaccaaaaaaagaagtg
aagttggagacacaactaaaaaaagaagagaagtcagagcctcaagttaagaaggaagca
aaactagcatcatctgaaaaaggccaaacacgcaaacagaacatcaccagaccagagcaa
gttattcctcatggtaaaccagaacaaaaagttcccaaacagataaaagctattacagca
gaaaagacagaaaaagctgaacgccaagaaaaataccatccatctataaaaacagaggga
aaaccagaagtcacagactcagggaagaagaaaattgaaaaacctgaaaaggaaagtaaa
gttccaccaaaacaagaaaatcttcaggtgcgcaatgtgactagagcggaaaaacgtgga
aaaatatcaaaagattccaaagatgcaccagctccaaagaaagataaagactccaaagat
gtcctgcattcaaagaaagataaagaagtaactaataatgtgtcttcaccaaagaagcaa
aaaagtcccatcagtttcttccaatgtgtctacttggatgggtacaatggctatggattt
cagtttcctgtcactcctgtccaacactctggagagaaccctggcaaatcaaactctcca
ggacagaagcagcaagaacaatag

DBGET integrated database retrieval system