KEGG   Rattus norvegicus (rat): 59301
Entry
59301             CDS       T01003                                 

Gene name
Ghrl
Definition
(RefSeq) ghrelin and obestatin prepropeptide
  KO
K05254  ghrelin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04024  cAMP signaling pathway
rno04080  Neuroactive ligand-receptor interaction
rno04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    59301 (Ghrl)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    59301 (Ghrl)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    59301 (Ghrl)
SSDB
Motif
Pfam: Motilin_assoc Motilin_ghrelin
Other DBs
NCBI-GeneID: 59301
NCBI-ProteinID: NP_067701
RGD: 632283
Ensembl: ENSRNOG00000010349
UniProt: Q9QYH7
Position
4q42
AA seq 117 aa
MVSSATICSLLLLSMLWMDMAMAGSSFLSPEHQKAQQRKESKKPPAKLQPRALEGWLHPE
DRGQAEEAEEELEIRFNAPFDVGIKLSGAQYQQHGRALGKFLQDILWEEVKEAPANK
NT seq 354 nt   +upstreamnt  +downstreamnt
atggtgtcttcagcgactatctgcagtttgctactcctcagcatgctctggatggacatg
gccatggcaggttccagcttcctgagcccagagcaccagaaagcccagcagagaaaggaa
tccaagaagccaccagctaaactgcagccacgagctctggaaggctggctccacccagag
gacagaggacaagcagaagaggcagaggaggagctggaaatcaggttcaatgctcccttc
gatgttggcatcaagctgtcaggagctcagtaccagcagcatggccgggccctgggaaag
tttcttcaggatatcctctgggaagaggtcaaagaggcgccagctaacaagtaa

DBGET integrated database retrieval system