KEGG   Rattus norvegicus (rat): 59319
Entry
59319             CDS       T01003                                 

Gene name
Ambra1
Definition
(RefSeq) activating molecule in BECN1-regulated autophagy protein 1
  KO
K17985  activating molecule in BECN1-regulated autophagy protein 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04137  Mitophagy - animal
rno04140  Autophagy - animal
rno05010  Alzheimer disease
rno05014  Amyotrophic lateral sclerosis
rno05016  Huntington disease
rno05017  Spinocerebellar ataxia
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    59319 (Ambra1)
   04137 Mitophagy - animal
    59319 (Ambra1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    59319 (Ambra1)
   05014 Amyotrophic lateral sclerosis
    59319 (Ambra1)
   05016 Huntington disease
    59319 (Ambra1)
   05017 Spinocerebellar ataxia
    59319 (Ambra1)
   05022 Pathways of neurodegeneration - multiple diseases
    59319 (Ambra1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    59319 (Ambra1)
   03029 Mitochondrial biogenesis [BR:rno03029]
    59319 (Ambra1)
Membrane trafficking [BR:rno04131]
 Autophagy
  Mitophagy
   PINK1-Parkin associated proteins
    59319 (Ambra1)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-dependent mechanism factors
    59319 (Ambra1)
SSDB
Motif
Pfam: ANAPC4_WD40 WD40 eIF2A Spt20 Acyl_CoA_thio
Other DBs
NCBI-GeneID: 59319
NCBI-ProteinID: NP_001127813
RGD: 621330
Ensembl: ENSRNOG00000017422
Position
3
AA seq 1300 aa
MKVVPEKNAVRILWGRERGTRAMGAQRLLQELVEDKTRWMKWEGKRVELPDSPTLDFLLA
FSPDRTLLASTHVNHNIYITEVKTGKCVHSLIGHRRTPWCVTFHPTISGLIASGCLDGEV
RIWDLHGGSESWFTDSNNAIASLAFHPTAQLLLIATANEIHFWDWSRREPFAVVKTASEM
ERVRLVRFDPLGHYLLTAIVNPSNQQGDDEPEIPIDGTELSHYRQRALLQSQPVRRTPLL
HNFLHMLSSRSSGIQVGEQSTVQDSATPSPPPPPPQPSTERPRTSAYIRLRQRVSYPTTV
ECCQHPGILCLCSRCAGTRVPSLLPHQDSVPPASARATTPSFSFVQTEPFHPPEQASSTQ
QDQGLLNRPSAFSTVQSSTAGNTLRNLSLGPTRRSLGGPLSSHPSRYHRELAPGLTGSEW
TRTVLTLNSRSEVESMPPPRTSASSVSLLSVLRQQEGGSQASVYTSATEGRGFPSSGLAT
ESDGGNGSSQNNSGNIRHELQCDLRRFFLEYDRLQELDQSLSGETPQTQQAQEMLNNNIE
SERPGPSHQPTPHSSENNSNLSRGHLNRCRACHNLLTFNNDTLRWERTTPNYSSGEASSS
WHVSTTFEGMPPSGNQLPPLERTEGQMPNSSRLELSSSASSQEERTVGVAFNQETGHWER
IYTQSSRSGTVSQEALHQDMPEESSEEDSLRRRLLESSLISLSRYDGAGSREHPIYPDPA
RLSPAAYYAQRMIQYLSRRDSIRQRSMRYQQNRLRSSTSSSSSDNQGPSVEGTDLEFEDF
EDNGDRSRHRAPRNARMSAPSLGRFVPRRFLLPEYLPYAGIFHERGQPGLATHSSVNRVL
AGAVIGDGQSAVASNIANTTYRLQWWDFTKFDLPEISNASVNVLVQNCKIYNDASCDISA
DGQLLAAFIPSSQRGFPDEGILAVYSLAPHNLGEMLYTKRFGPNAISVSLSPMGRYVMVG
LASRRILLHPSTEHMVAQVFRLQQAHGGETSMRRVFNVLYPMPADQRRHVSINSARWLPE
PGLGLAYGTNKGDLVICRPEALNSGIEYYWDQLNETVFTVHSSSRSSERPGTSRATWRTD
RDMGLMNAIGLQPRNPTTSVTSQGTQTLALQLQNAETQTEREEEEPGTASSGPGEGEGSE
YGGSGEDALSRIQRLMAEGGMTAVVQREQSTTMASMGGFGNNIIVSHRIHRSSQTGTESG
AARTSSPQPSTSRGLLSEPGQLAERGLSPRTASWDQPSTSGRELPQPALSSSSPVPIPVP
LASNEGPTMHCNVTNNSHLPEGDSSNVGEAAGPSGEPRNR
NT seq 3903 nt   +upstreamnt  +downstreamnt
atgaaagttgtcccagagaagaatgctgtacgaatcctctggggccgagagcggggcact
cgtgccatgggtgcccagcggcttctgcaggagctggtggaggataagactcgatggatg
aaatgggagggcaagagagtagaacttcctgatagtcccacgctcgacttcttactggcc
ttcagcccagacaggactctcttggcgtccacacatgtgaaccataacatctatattaca
gaggttaagactggcaagtgtgttcactctctgattggacaccgccgtactccatggtgt
gtcacttttcatcccactatctcaggccttattgcttctggctgcctagatggggaagtt
aggatttgggacttacatggtggcagtgaaagctggttcacagatagcaacaatgccata
gcttctttggctttccaccctacggctcagctcctgctgatcgccactgcaaatgagatc
catttctgggattggagtcgtcgggaaccctttgctgtggtgaaaacagctagtgagatg
gagcgtgttcgtctggtgagatttgatccacttggacactacttacttacagctattgtt
aacccctctaatcagcagggtgatgatgaaccagaaatccctatagatggaacagaatta
tctcattaccgtcagcgtgccctcctgcaatcacagccagttcgccggacacccctcctc
cacaatttcctgcatatgctgtcctcccgctcctctggcatccaggtgggagagcaaagc
acagtacaagattctgctaccccctcacccccaccgcctccccctcagccctccacggag
cgtcccaggacttccgcttacatcagactccgacagcgggtcagttaccccaccacagtt
gagtgctgccagcaccctgggatcctgtgcctttgcagccgttgtgctggcactcgagtt
ccttccctcttgccacaccaggacagtgtcccccctgcttctgccagagctactacccct
tccttttcttttgtacagaccgagcccttccatcccccggagcaggcttcatcaacgcag
caggaccaaggcctcctgaaccggccgtctgccttcagtacagtccagagcagcactgcg
ggcaacacgctccgcaacctcagtctgggtcctacccgtcgctctttggggggcccactg
tccagccacccatctaggtatcacagagaactagcccctgggctgacaggttctgagtgg
acccggacagtactcactctgaactcacgttctgaggtagaatctatgcccccaccgagg
accagtgcctcctcagtgagtttgctttctgtactgagacagcaggaaggtggctctcag
gcatctgtgtatacttcagccacagaagggaggggttttccatcatcagggttggcaact
gagtcagatggagggaatggttccagccaaaacaactcaggcaacattcgccatgagctt
cagtgtgacctgagacgcttttttttggagtatgacaggctgcaggagctggatcagagc
ctgagtggggaaactccccagacccaacaggcccaggaaatgctcaacaataatattgaa
tctgagagaccaggtccttcccatcagcctaccccacacagcagtgagaacaactccaac
ctttctcggggccaccttaatcgatgccgtgcttgccataatcttctaaccttcaacaat
gatacccttcgttgggaaagaaccacacctaactactcatccggtgaggctagctcttcc
tggcatgtctccactacttttgagggcatgccaccgagtggcaaccaactaccacctctt
gagcggactgagggccaaatgcctaactccagcaggctggagttgagcagttctgctagt
tcacaagaggagaggactgtgggggtggcctttaaccaggagaccggccattgggaacga
atttatacccagtccagcagatctggaactgtatcacaggaggccttacatcaagatatg
cctgaggaaagctctgaggaagactccctgaggaggaggctgctggagtcttccctcatt
tcattatcccgttatgatggagcaggatccagagagcacccaatttacccagacccagcg
agattatctcctgctgcatactacgcccagaggatgatccagtatctctcaaggagagac
agtattcgccagcgctccatgcgctaccaacagaatcggcttcgttcttccacctcctct
tcttcctcagacaaccagggtccatcagtagagggaaccgacttggaatttgaggacttt
gaggacaatggtgacagatctaggcaccgagctccccgaaatgcccgaatgtctgcacca
tcacttggacgctttgtcccaaggcgttttttgctgcctgagtacttgccttatgctggg
atttttcatgagcgtggacagcctggcttggctactcattcttctgttaacagggtcctg
gcaggggcagtaattggagatggacagtctgctgtggccagtaacattgccaatactacc
tacaggctccagtggtgggacttcaccaagtttgaccttccagaaatcagtaatgcctcc
gtgaatgtcctggtacagaactgcaagatctacaatgatgccagctgtgacatttctgca
gatggccagctcctggcagctttcatcccgagtagccagaggggctttcctgatgaaggc
atcctggcagtgtattccctggccccccataacttgggggaaatgctctacaccaagcga
tttggtcccaatgccatttctgtaagcctgtccccaatgggccgatacgttatggtgggc
ttggcctcacgaaggatcctgctgcacccctctacagagcacatggtagcccaggtcttc
aggctgcagcaggcccatggtggtgagacttccatgaggagagttttcaacgtcctttac
cccatgcctgcggaccagcggagacacgtcagcatcaactctgcccgctggctacctgag
ccagggctcggtttggcctatggcaccaacaaaggagacctggtgatctgccgaccagag
gccttaaactctggcattgagtactactgggaccagctaaatgaaacggtcttcactgtc
cactcaagtagcaggagcagcgagcggcctggaaccagcagagccacatggcggacagac
agagacatgggcttgatgaatgcaattgggctgcaacctcggaaccctaccacctctgtg
acatctcagggcacccagactctggccctccagttgcagaatgctgaaacacagactgag
agggaggaagaggaaccagggacagcatcctcaggtcctggtgaaggcgagggctcggaa
tatggtggcagtggggaagatgccctcagccggatccagaggctaatggccgagggtggc
atgacagctgtggtacagcgagaacagagtaccaccatggcctccatgggtggcttcggc
aacaacatcatcgttagccaccgcattcaccgcagctcccagacaggcacagagtcaggg
gctgctcgtacctcctcaccccagccctccacctctcgaggactactctcagaacctggg
caactggcagagcgaggactaagcccccggacagcctcctgggaccagcctagtacctct
ggaagggaactaccccagccagccctgtcctcttcctcccctgtccccattccagtcccc
cttgccagcaatgagggaccaaccatgcactgcaatgtgaccaataacagtcaccttcct
gagggtgatagtagcaatgtgggggaagctgcaggccctagtggggagccacggaaccga
tag

DBGET integrated database retrieval system