KEGG   Rattus norvegicus (rat): 59323
Entry
59323             CDS       T01003                                 

Gene name
Erbb4
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-4 precursor
  KO
K05085  receptor tyrosine-protein kinase erbB-4 [EC:2.7.10.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04012  ErbB signaling pathway
rno04020  Calcium signaling pathway
rno04151  PI3K-Akt signaling pathway
rno05014  Amyotrophic lateral sclerosis
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    59323 (Erbb4)
   04012 ErbB signaling pathway
    59323 (Erbb4)
   04020 Calcium signaling pathway
    59323 (Erbb4)
   04151 PI3K-Akt signaling pathway
    59323 (Erbb4)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    59323 (Erbb4)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    59323 (Erbb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    59323 (Erbb4)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     59323 (Erbb4)
Protein kinases [BR:rno01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   59323 (Erbb4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like Haspin_kinase APH DUF3951
Other DBs
NCBI-GeneID: 59323
NCBI-ProteinID: NP_067719
RGD: 620486
Ensembl: ENSRNOG00000014248
UniProt: Q62956
Position
9
AA seq 1308 aa
MKLATGLWVWGSLLVAARTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVM
GNLEITSIEHNRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIF
LNYRKDGNFGLQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVST
IGSSGCGRCHKSCTGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSG
PKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVVD
SSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCT
KINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFST
VNQRIVIRDNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYD
GEFREFENGSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGA
NSFIFKYADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGG
LFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTPSGTAPNQAQLRILKETELKR
VKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASVDHPHL
VRLLGVCLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQ
SDVWSYGVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMID
ADSRPKFKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAE
EYLVPQAFNIPPPIYTSRTRIDSNRSEIGHSPPPAYTPMSGNQFVYQDGGFATQQGMPMP
YRATTSTIPEAPVAQGATAEMFDDSCCNGTLRKPVVPHVQEDSSTQRYSADPTVFAPERN
PRAELDEEGYMTPMHDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAED
EYVNEPLYLNTFTNALGNAEYMKNSLLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQ
EYSTKYFYKQNGRIRPIVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV
NT seq 3927 nt   +upstreamnt  +downstreamnt
atgaagctggcgacgggactgtgggtctgggggagccttctggtggcagccaggaccgtc
cagcccagcgcttctcagtcagtgtgtgccggaacagagaacaaactgagctctctctct
gatctggagcagcagtaccgagccttgcgcaaatactatgaaaactgcgaggtagtcatg
ggcaacctggagatcaccagcatagagcacaaccgggacctctccttcctgcggtctatc
cgagaagtcacaggctatgtacttgtggccctcaaccagtttcgttacctgcctctggag
aatttacgcattattcgtgggacaaaactgtatgaagatcgctatgccttagcaatattc
ttaaactacaggaaagatggcaactttggacttcaagaactgggattaaagaacctgacc
gaaatactaaatggtggagtctatgtagaccagaacaaattcctatgttatgctgatact
atacactggcaagatattgttcggaatccatggccttccaacatgactctggtgtcaaca
attggaagttctggatgcggaagatgccataagtcttgcactggtcgatgctggggaccc
acagaaaatcactgccagaccttgaccaggactgtgtgtgctgaacaatgtgatggcagg
tgctatggaccctacgtcagtgactgctgccatcgagaatgtgccggaggctgctcagga
ccaaaagacactgactgctttgcctgcatgaacttcaatgacagtggagcctgtgttact
cagtgtccccaaacgttcgtctacaatccaaccacctttcaactggaacacaacttcaat
gcaaagtacacatatggagcattctgtgttaagaaatgtccacataacttcgtggtagat
tccagttcttgtgtacgagcctgccctagttccaagatggaagtcgaagaaaatggaatt
aaaatgtgtaagccttgcactgatatttgccccaaagcatgtgatggaatcggcaccgga
tccttgatgtctgctcagactgtggattccagtaacattgacaaattcataaactgcacc
aagatcaacgggaatctcatctttcttgtcactggcattcatggtgacccttacaatgct
attgacgccatagacccagagaaactgaatgtctttcggacagtcagagaaataacaggt
ttcctgaacatacaatcttggcccccaaatatgacagatttcagtgttttctccaacctt
gtaaccattggaggaagagtcctctacagtggtctctcattgcttatcctcaaacaacaa
ggtatcacttcactacagttccagtctctgaaggaaatcagtgcgggcaatatctacatc
acggacaacagcaacctgtgttattaccacaccatcaactggacaacactgttcagcacc
gttaaccagaggatagtgatccgagacaacaggagggctgagaactgtactgctgaaggg
atggtgtgtaaccacctgtgttcaaatgatggttgttggggacctgggccagaccagtgt
ctgtcatgtcggcgcttcagcaggggaaagatctgtatagagtcctgcaacctttatgat
ggggagtttcgagagtttgaaaacggctccatctgtgttgagtgtgactcccagtgtgag
aaaatggaagacggactcctcacatgccatggaccgggacctgacaactgtacaaagtgt
tctcattttaaagatggtcctaactgtgtagagaaatgtccagatggcctacagggagca
aacagtttcatatttaagtacgcagatcaggatcgggagtgccacccttgccatccaaac
tgcacccaggggtgtaacggtcccactagtcatgactgcatttactacccatggacgggc
cattccactttaccacaacatgctagaactccactgattgcagccggagtcattggaggg
ctcttcatcctggtcatcatggctctgacatttgccgtttatgtcagaaggaagagcatc
aaaaagaaacgcgctttgagaagattcctggagacagagctagtcgagcccttaacccct
agtggcacagcacccaatcaagctcaacttcgaattttgaaggaaacagagctaaagagg
gtaaaagtccttggctcgggagcatttggaaccgtttataaaggaatctgggtgcctgaa
ggtgaaactgtgaaaatccctgtggctattaagatcctcaatgagacaactggccccaaa
gccaatgtggagttcatggatgaggcactgattatggcaagtgtggatcacccacaccta
gtgcgtttactgggtgtgtgtctgagccccactatccagttggttactcagttgatgcca
catggctgcctactggaatatgtccacgaacacaaggataacatcggatcacagctgctg
ttgaactggtgtgtccagattgctaagggaatgatgtatctggaggaaaggcggcttgtt
catcgggatctggcagcccgcaatgtgttggtgaaatctccaaatcatgttaaaatcaca
gactttggactggcccggctcttggaaggagatgaaaaagaatacaatgctgacggtggc
aagatgccaattaaatggatggctctggaatgtatacattataggaaattcacacatcaa
agcgatgtttggagctacggtgtcactatatgggaactgatgacctttggaggaaagccc
tatgatggaattccaacgcgagaaatccctgacttattagagaagggagagcgtttgcct
caacctcccatctgcactattgacgtttacatggtcatggtcaaatgttggatgatcgat
gctgacagcagacctaaattcaaagaactggctgctgagttttcaaggatggctagagac
cctcaaagatacctagtaattcagggggatgatcgcatgaagcttcccagtccaaacgac
agcaaattcttccagaatctcttggatgaagaggatttggaagatatgatggacgctgag
gaatatttggtcccccaggctttcaatatcccacctcctatctacacatccagaacaaga
attgactccaataggagtgaaattggacacagccctcctcctgcctacacccccatgtcg
ggaaatcagtttgtgtaccaggatgggggtttcgctacacaacaaggaatgcccatgccc
taccgagccacaaccagcaccataccagaggctccagtcgcccagggtgcaacggctgag
atgtttgatgactcctgctgtaatggtaccctgcgaaagccagtggtaccccacgtccaa
gaggacagtagcactcagaggtatagtgccgaccccacagtgttcgccccagaacggaac
cctcgagcagaactggatgaagaaggctacatgactcccatgcatgacaagccaaaacaa
gaatatctgaatcctgtggaagagaacccttttgtgtcccggaggaagaatggagacctt
caagctttagataatccagagtatcacagcgcttccagcggtccccccaaggcagaggat
gagtacgtgaatgagcccctttatctcaacaccttcaccaacgccttgggaaatgcagag
tacatgaaaaacagcttactgtctgtgccagagaaagccaagaaagcatttgacaacccc
gactactggaaccacagcctgccaccccggagcactcttcagcacccagactacctgcag
gaatacagcacaaaatatttttataaacagaatggacggatccgccctattgtggcagag
aatcctgagtacctctcagagttctcgctgaagccaggcactatgctgccccctccgccc
tacagacaccggaatactgtggtgtga

DBGET integrated database retrieval system