KEGG   Rattus norvegicus (rat): 59326Help
Entry
59326             CDS       T01003                                 

Gene name
Rapgef3, Epac
Definition
(RefSeq) Rap guanine nucleotide exchange factor 3
  KO
K08014  Rap guanine nucleotide exchange factor 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04015  Rap1 signaling pathway
rno04024  cAMP signaling pathway
rno04072  Phospholipase D signaling pathway
rno04261  Adrenergic signaling in cardiomyocytes
rno04670  Leukocyte transendothelial migration
rno04720  Long-term potentiation
rno04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    59326 (Rapgef3)
   04072 Phospholipase D signaling pathway
    59326 (Rapgef3)
   04024 cAMP signaling pathway
    59326 (Rapgef3)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    59326 (Rapgef3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    59326 (Rapgef3)
  09156 Nervous system
   04726 Serotonergic synapse
    59326 (Rapgef3)
   04720 Long-term potentiation
    59326 (Rapgef3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF cNMP_binding DEP RasGEF_N HTH_Tnp_4
Motif
Other DBs
NCBI-GeneID: 59326
NCBI-ProteinID: NP_067722
RGD: 621869
Ensembl: ENSRNOG00000059961
UniProt: Q9Z1C8
Position
7q36
AA seq 884 aa AA seqDB search
MVLKRMHRPRCCSYQLVFEHRRPSCIQGLRWTPLTNSEGSLDFRVSLEQATTEHVHKAGK
LLYRHLLATYPTLIRDRKYHLRLHRQCCSGRELVDGILALGLGVHSRSQAVGICQVLLDE
GALCHVKHDWTFQDRDAQFYRFPGPEPQPAGTHDVEEELVEAMALLSQRGPDALLTVALR
KSPGQRTDEELDLIFEELVHIKAVAHLSNSVKRELAAVLLFEPHSKAGTVLFSQGDKGTS
WYIIWKGSVNVVTRGKGLVTTLHEGDDFGQLALVNDAPRAATIILRENNCHFLRVDKQDF
NRIIKDVEAKTMRLEEHGKVVLVLERTSQGAGPSRPPTPGRNRYTVMSGTPEKILELLLE
AMRPDSSAHDPTETFLSDFLLTHSVFMPCTQLFAALLHHFHVEPSEPAGGSEQERSTYIC
NKRQQILRLVSRWVALYSPMLRSDPVATSFLQKLSDLVSRDTRLSNLLREQYPERRRHHR
LENGCGNVSPQTKARNAPVWFPNHEEPLPSSAGAIRVGDKVPYDICRPDHSVLTLHLPVT
ASVREVMAALAHEDHWTKGQVLVKVNSAGDVVGLQPDARGVATSLGLNERIFVVDPQEVH
ELTPHPEQLGPTLGSSEMLDLVSAKDLAGQLTEHDWNLFNRIHQVELIHYVLGPQHLRDV
TTANLERFMRRFNELQYWVATELCLCPVPGPRAQLLRKFIKLAAHLKEQKNLNSFFAVMF
GLSNSAISRLAHTWERLPHKVRKLYSALERLLDPSWNHRVYRLALTKLSPPVIPFMPLLL
KDMTFIHEGNHTLVENLINFEKMRMMARAVRMLHHCRSHSTAPLSPLRSRVSHIHEDSQA
SRISTCSEQSLSTRSPASTWAYVQQLKVIDNQRELSRLSRELEP
NT seq 2655 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgaagagaatgcaccgtccccggtgctgctcttaccagctagtgttcgagcac
cggcgcccaagctgcatccagggacttcgctggacgccacttaccaacagtgagggctcc
ctggacttcagagtgagcctggagcaggccaccacagagcatgtgcacaaggccgggaag
ctcctgtaccgtcatctcttggcaacgtaccctaccctcatccgagacagaaaataccat
ctgcgactacatcggcagtgctgctctggccgggagctagtggatgggatcttggctctg
ggtcttggggtccactcacggagccaagctgtgggcatctgccaggtgttgctggatgag
ggtgccctttgccatgtaaaacatgactggaccttccaggaccgagacgcccaattctac
agattccctggaccggagccccagcctgcaggaactcatgacgtggaagaggagcttgtt
gaggcaatggccctactctcccagcgagggcctgatgccctactcactgttgcactccgg
aagtccccgggtcagcgtacagatgaagagctggacctcatcttcgaggagctcgtacat
atcaaggcggtggctcacctttctaactcggtgaaacgggaactagctgctgttctgctc
tttgaaccacacagcaaggcaggaactgtgttgttcagccagggggacaagggtacctca
tggtacattatctggaagggatctgtcaatgtggtgacccgtggcaaggggctggtgacc
acgttgcacgagggagatgactttggacagctggctctggtgaacgacgcacctcgagca
gccaccatcatccttcgagaaaataactgtcactttctgcgtgtggacaagcaggacttc
aaccgcatcatcaaggatgtggaagcaaaaaccatgagactggaagaacacggcaaagtg
gtgttagttttggagagaacctctcagggtgctggcccttcccgccctccgaccccaggc
aggaaccgatatacggtaatgtctggcaccccagagaaaatcctagaactcctgttggag
gctatgagaccggattccagtgctcatgacccaacagagacattcctcagtgacttcctg
ctgacgcacagtgtcttcatgccctgcacacagctctttgccgccctcctgcaccacttc
cacgtggagccatcagagcctgccgggggcagcgagcaggaacgcagcacctacatctgc
aacaagaggcagcagattctgcgtctggtcagccggtgggtggccctctacagccccatg
ctccgctcagatcccgtggccaccagcttcctccagaaactctcagacctggtgagcaga
gatacccgacttagcaacttgctgagggaacagtatccggagagacggcgacaccacagg
ttggagaatggctgtgggaatgtatctcctcagaccaaggcccggaatgcacctgtttgg
tttcctaaccatgaggaacccctcccaagcagcgctggggccatccgagtcggggacaaa
gtcccctatgatatctgcagacccgaccactcggtgctgaccctgcacctgccggtgaca
gcctccgtgagggaagtgatggcagctttggcccatgaggaccactggaccaaggggcag
gtgctggtaaaggtcaattctgccggtgatgtcgttggcttgcagccagatgcccgcggt
gtggccacatccctggggctcaatgagcggatctttgttgtcgacccacaggaagtgcac
gagctgaccccacaccctgagcagctggggcccactctgggttcttctgagatgctggac
ctagtgagtgccaaggacctggcaggccagctcacagagcatgactggaacctcttcaac
aggatccaccaggtggagctgatccactatgtactgggcccccagcacctgcgggacgtc
accactgcaaacctggagcgcttcatgcgacgcttcaacgagctgcagtactgggtggcc
accgaactctgtctctgcccggttcctggcccccgggctcagctactccggaagttcatc
aagctggcagcccacctcaaggagcagaagaatctcaactctttctttgcggtcatgttt
ggcctcagcaactcggccatcagccgcctggcccacacctgggagcgtctgccccataaa
gtacggaagctgtactcggccctggaaaggttgctggacccttcctggaaccaccgagtg
taccgattggctctcaccaagctctctcctcctgtcatccctttcatgcccctgctactc
aaagacatgaccttcattcatgaagggaaccacacactggtagaaaacctcatcaacttt
gagaagatgcgaatgatggccagagccgtgcggatgctccaccactgccgaagccacagc
accgcgcctctatcaccactcagaagccgggtttcccacatccacgaggacagccaggca
tcaagaatctccacatgttccgagcagtccctgagcacccggagtccagccagcacctgg
gcttatgtccagcagctgaaggtcattgacaaccagcgggaactgtcccgcctctcccgg
gaactggaaccatga

DBGET integrated database retrieval system