KEGG   Rattus norvegicus (rat): 59329
Entry
59329             CDS       T01003                                 

Gene name
Sik1
Definition
(RefSeq) serine/threonine-protein kinase SIK1
  KO
K19008  serine/threonine-protein kinase SIK1 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    59329 (Sik1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    59329 (Sik1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     59329 (Sik1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   59329 (Sik1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Haspin_kinase ABC1 Kdo
Other DBs
NCBI-GeneID: 59329
NCBI-ProteinID: NP_067725
RGD: 69407
Ensembl: ENSRNOG00000001189
UniProt: Q9R1U5
Position
20
AA seq 776 aa
MVIMSEFSAVPTGTGQGQQKPLRVGFYDVERTLGKGNFAVVKLARHRVTKTQVAIKIIDK
TRLDSSNLEKIYREVQLMKLLNHPNIIKLYQVMETKDMLYIVTEFAKNGEMFDYLTSNGH
LSENEARKKFWQILSAVEYCHNHHIVHRDLKTENLLLDGNMDIKLADFGFGNFYKPGEPL
STWCGSPPYAAPEVFEGKEYEGPQLDIWSLGVVLYVLVCGSLPFDGPNLPTLRQRVLEGR
FRIPFFMSQDCETLIRRMLVVDPAKRITIAQIRQHRWMQADPTLLQQDDPAFSMQGYTSN
LGDYNEQVLGIMQALGIDRQRTVESLQNSSYNHFAAIYYLLLERLREHRSTQPSSRATPA
PARQPQLRNSDLSSLEVPQEILPCDPFRPSLLCPQPQALAQSVLQAEIDCDLHSSLQPLF
FPLDTNCSGVFRHRSISPSSLLDTAISEEARQGPSLEEEQEVQEPLPGSTGRRHTLAEVS
THFSPLNPPCIIVSSSAAVSPSEGTSSDSCLPFSASEGPAGLGGGLATPGLLGTSSPVRL
ASPFLGSQSATPVLQSQAGLGATVLPPVSFQEGRRASDTSLTQGLKAFRQQLRKNARTKG
FLGLNKIKGLARQVCQSSIRGSRGGMSTFHTPAPSSGLQGCTASSREGRSLLEEVLHQQR
LLQLQHHSAVSSDYQQAPQLSPVPYVLTPCDGLLVSGIPLLPTPLLQPGMSPVASAAQLL
DAHLHISAGPVALPTGPLPQCLTRLSPSCDPAGLPQGDCEMEDLTSGQRGTFVLVQ
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggtgatcatgtcggagttcagcgcggtccccacaggcaccggccagggccagcagaag
cccctccgggtgggcttttacgacgtggaacgaaccctgggcaaaggcaattttgcagtg
gttaagctggcgcggcaccgagtcaccaaaacgcaggttgcaattaaaataattgacaag
acacggttagattctagtaatctggagaagatctaccgggaggtccagctcatgaaactc
ctgaaccacccaaatattatcaagctttaccaggttatggagacaaaagacatgctgtac
attgtcacggagtttgccaaaaatggagaaatgttcgattatctgacttccaacgggcac
ttgagtgaaaacgaggctaggaagaaattctggcagatcctgtcagccgtggagtactgc
cacaaccatcacatcgtccaccgggaccttaagacagagaaccttctgctggacggcaac
atggacatcaagctggcagattttggatttgggaatttctacaagccaggggagcctctg
tctacttggtgtgggagccccccctatgctgctcccgaagtctttgaggggaaggagtat
gaaggtccccagctggacatctggagcctcggcgtggtgctgtatgtcctggtctgtggc
tccctcccttttgatggacccaacctgcctacgctgagacagcgggtgctggagggccgc
ttccgcatccccttcttcatgtctcaagactgtgagacactgatcagacgcatgctggta
gtggaccccgccaagcgcatcaccattgcccagatccgccagcaccgatggatgcaggcc
gaccccaccctcctgcagcaggacgaccctgccttctccatgcagggctacacctccaac
ctgggcgactacaacgagcaggtgctgggcatcatgcaggccctgggcatcgaccggcag
aggacagtagagtctctacagaacagcagctacaaccactttgcggctatttactacctc
ctgctcgagcgcctcagggagcatcgaagcacccagccctcatcccgggccacccctgca
cctgccagacagcctcagctccgaaactcagacctcagcagtctggaggttcctcaagaa
attctcccatgtgaccctttccggccctctctgctgtgcccgcagccccaggccttggct
cagtctgtcctgcaggctgagatagactgtgatctccacagttcgcttcagcccttattc
ttccccctggataccaactgcagcggagtgttccggcaccgatccatctcccccagcagc
ctgctggacacagctatcagtgaggaggccaggcagggtcccagcctggaggaggagcag
gaggtccaggaacccctgcctggcagcactggccggaggcatacactggctgaagtttcc
acccacttctccccgctcaaccctccttgcataattgtctcctcctctgccgctgtgagt
ccctcggaaggaactagctctgacagctgcctccccttctctgcaagcgaaggtcctgca
gggcttggtggtggcctggccaccccagggcttctgggcaccagctctccagtcagattg
gcctcacccttcctgggatcacagtcagccacccctgtgctacagagtcaggcaggtctg
ggtgcgactgtcttacctcctgtcagcttccaggagggacggagagcgtcggatacgtct
ctcactcaagggctgaaggccttccggcagcagctaaggaaaaacgcgaggaccaagggg
ttcctgggactgaacaagatcaaaggattggcccgtcaggtgtgccagtcctccatccga
ggttcccggggagggatgagtaccttccacaccccggccccaagctcaggtctgcaaggc
tgcacggccagcagtcgcgagggcaggagcctgctcgaagaggtgctgcaccagcagagg
ctgctccagttacagcaccactcagccgtctcatctgactaccagcaggccccccaactg
tcccccgtcccctacgtgctcactccctgtgatggccttctcgtgtctggaatcccactg
ctgccaacgcccctcctccagcccggcatgtcccccgtggcgtctgccgcgcagctcctg
gatgcccacttgcacatcagtgctggcccagtggccctccccactggtcccctgccacag
tgcctcaccaggctgtccccaagctgtgatcctgctgggctgccgcagggggattgtgag
atggaggacctgacctctggccagcgggggacgttcgtcctggtacagtga

DBGET integrated database retrieval system