KEGG   Rattus norvegicus (rat): 60323Help
Entry
60323             CDS       T01003                                 

Gene name
Arhgef1, Lsc
Definition
(RefSeq) Rho guanine nucleotide exchange factor 1
  KO
K12330  Rho guanine nucleotide exchange factor 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04270  Vascular smooth muscle contraction
rno04611  Platelet activation
rno04810  Regulation of actin cytoskeleton
rno04928  Parathyroid hormone synthesis, secretion and action
rno05200  Pathways in cancer
rno05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    60323 (Arhgef1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    60323 (Arhgef1)
  Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    60323 (Arhgef1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    60323 (Arhgef1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    60323 (Arhgef1)
   05205 Proteoglycans in cancer
    60323 (Arhgef1)
Membrane trafficking [BR:rno04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    60323 (Arhgef1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RGS-like RhoGEF PH_13
Motif
Other DBs
NCBI-GeneID: 60323
NCBI-ProteinID: NP_067726
RGD: 620951
Ensembl: ENSRNOG00000020130
UniProt: Q5BK37
Position
1q21
AA seq 919 aa AA seqDB search
MGEVAGGAAPGPPRSGLVSIIIGAEDEDFENELEANPEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVTRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEEMQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEVDEKPGPADRKG
SLGISSRDRTVGTPGQDNPGVSLHPLSVDSLDSREPGVDTPQEPGDTPPQGPTSLEPLAP
PESTEDNGETESPEPGDDGEPGRSGLEQEPEEPPGWRELVPSDTLLGLPKNQVKRQEVIS
ELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPLEELQNIFPSLDELIEVHSLFLDRLMKRR
QESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQE
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERAKVELAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLTHLRQSNDPMLSEFKNLDITKKKLVHEGPLTWRLTKDK
AVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTSSERKSWCALITETAGSLKVPAPASRPKPRPSPSSTRE
PLLSSSENGTGGTEAAPADARTERILNDLLPFCRPGPEGQLAATALQKVLSLKQILLSTE
EDSGAGPPRDGDGVPGGGAPGPTHTQEVEENLLSLEVVIKQLEELEEEFCRLRPFLSQLG
EILSPNLAAPERSAQTGLS
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagtcgccggaggggcggccccagggcctccccggtctggcctggtgtccatc
atcatcggggctgaggatgaggactttgagaatgaactggaggcgaacccagaagatcaa
aacagccagttccagagcctggagcaagtgaagcgtcgcccagcccacctcatggccctc
ctgcaacacgtggccctgcagttcgagccaggaccactgctctgctgcctgcatgctgac
atgctaagctcactgggccccaaagaagccaagaaggccttcctcgatttctatcacagt
ttcctggagaagactgcggttctgcgggtgccggtccctcccagcgttgcttttgaactt
gatcgtactcggcctgatctcatctctgaggatgtccagaggcggttcatacaagaggtg
gtacagagccagcaggcagccgtgacccgtcagctagaggacttccgctccaaacggctc
atgggcatgacaccctgggagcaggaactgagcctgctagagccctggattgggaaagac
cggggcaactatgaggcccgggagcggcatgttgcagagcggctgctctcccacctagag
gaaatgcaacataccatctccacagatgaagaaaaaagtgctgctgtggtcactgcaatc
agcctgtatatgcgccaccttggggtccggaccaagagtggggacaagaagtcagggagg
aacttcttccggaaaaaggtgatggggaatcggcggtcagacgagccccccaagacaaag
aaagggctgagcagtatcctagatcctgcccgctggaaccggggagagccatctgctcca
gactgtcgacatctaaaggtcgaggttgatgagaagccaggccctgcagaccggaaggga
agcctgggtatttcatctcgggacaggactgttgggactcctgggcaggacaacccagga
gtctccctgcaccctctgtctgtagacagcctggattcccgggaaccaggtgtggatacc
ccgcaggagccaggagatacacccccacaaggccctacaagcctggagcccctggcaccc
ccagagagcacagaggacaatggcgagactgaaagccctgagcctggagatgatggagag
ccagggcggtcaggcctggaacaggaaccagaagaacctcctgggtggagggaactggtg
ccctcagacaccctgctcggcctgcccaagaaccaagtgaagcggcaagaggtcatcagt
gagctgctggtgacggaggcggctcacgtccgcatgctacgggtactacatgacctcttc
taccagcccatggcagaagggggcttcttccctctggaggaactgcagaacatctttccc
agcctggatgagctcatcgaggtgcactccctgttcctcgatcgcttgatgaagcggaga
caagagagtggctacctcattgaggagattggtgatgtgctactggcccggttcgatggt
gctgagggctcatggttccagaagatctcttcccgcttctgcagccgccagtcattcgct
ctagagcagctcaaagccaagcagcgcaaggagcctcgattctgtgcctttgtgcaggaa
gctgagagccgcccccgctgccggcggctgcagttgaaggacatgatccccactgagatg
cagcggctgaccaagtacccactgctgctgcagagtattgggcagaacacagaagagcct
gccgagcgggcaaaggtggaacttgcagctgagtgctgccgtgagattctgcaccacgtt
aatcaagctgtccgtgacatggaggacctgctgcggctcaaggattaccagcggcgcctg
gacttgactcacctgcggcagagcaatgacccaatgctgagcgagttcaagaacctggat
atcactaagaagaagttggtccatgaaggccccctcacgtggcgactaaccaaagacaaa
gctgtagaggtccacgtgctattgctggacgacctgctgctgctgctccagcgccaggat
gagaggctgctgctcaagtcacacagccggacgctgacacccacacccgacggcaagacc
atgctgcggcctgtgctccggctcacctctgccatgacccgggaggtggccactgatcac
aaagctttttacgtcatttttacctgggaccaggaggcccagatatatgagctggtggca
cagacatcgtcggaacgcaagagctggtgtgccctcatcacagagactgccggatccctg
aaggtccctgcccctgcctcccgccccaaaccccggcccagcccaagcagcacccgagaa
cccctgctcagcagctctgagaatggcactggaggcacagaggccgctccagctgatgcc
cggacagagcggatcctcaacgacctcctgcccttctgcagaccaggcccagagggccag
cttgctgccacagccctccagaaagtactgtccctgaaacagatcctgttgagcactgag
gaagacagtggagcagggcctccccgcgatggggatggggtgcctggtggtggtgcccca
ggcccaacacacacccaggaggttgaggaaaacctgttgagcctagaagtggtcatcaaa
caactggaggagttagaagaggaattttgtcgcctaagacccttcctgtctcagcttggg
gagattctgtcccccaacctggctgcacctgagcgctctgctcagacaggcctttcatga

DBGET integrated database retrieval system