KEGG   Rattus norvegicus (rat): 60326Help
Entry
60326             CDS       T01003                                 

Gene name
Kcnv1, Kv8.1
Definition
(RefSeq) potassium voltage-gated channel modifier subfamily V member 1
  KO
K04934  potassium channel subfamily V member 1
Organism
rno  Rattus norvegicus (rat)
Brite
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated
   60326 (Kcnv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans BTB_2 Ion_trans_2 BTB_3
Motif
Other DBs
NCBI-GeneID: 60326
NCBI-ProteinID: NP_067729
RGD: 621264
Ensembl: ENSRNOG00000004117
UniProt: P97557
Position
7q31
AA seq 503 aa AA seqDB search
MDLSPRNRPLLDSSSLDSGSLTSLDSSVFCSEGEGEPLALGDCLTVNVGGSRFVLSQQAL
SCFPHTRLGKLAVVVASYRRLGALAAAPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYY
RTGRLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTDDQESQ
HESEQDFSQGPCPTVRQKLWDILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWL
NLQLLEILEYVCISWFTGEFILRFLCVKDRCHFLRKVPNIIDLLAILPFYITLLVESLSG
SHTTQELENVGRLVQVLRLLRALRMLKLGRHSTGLRSLGMTITQCYEEVGLLLLFLSVGI
SIFSTIEYFAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGI
LVLALPIAIINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDIYARSIM
EMLRLKGRERASTRSSGGDDFWF
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atggatctgtcaccccgcaaccggccgcttctggactcgtcctcgctggacagtggctcc
ctgacctcgctggactccagcgtcttctgcagcgagggcgaaggggaacccttggctctg
ggggactgccttacggtcaacgtgggaggcagccgcttcgtgctctctcagcaagctctg
tcctgcttcccgcacacgcgcctgggcaaactggccgtggtggtggcctcctaccgccgc
ctgggcgccctggctgcagcccccagccccttggagctttgtgatgatgccaacccggta
gacaacgagtacttcttcgaccgcagctctcaggcattccgttatgtcctacactattat
cgcactggccgcttgcacgtcatggagcagctctgtgcactctcctttcttcaggagatc
cagtactggggcatcgatgaactcagcatcgactcctgctgcagggacagatacttcaga
agaaaggagctgagtgaaactcttgacttcaagaaggacacagatgaccaggaaagtcaa
catgagagtgaacaggacttctcacaaggaccttgtcctaccgtccgacaaaagctctgg
gatattctggagaagcctgggtcttccacagcagcccggatctttggagtgatctccatc
atttttgtggcagtgtccatcgtcaacatggccctgatgtcagctgagctaagctggctc
aacctacagctgctggagattttggagtatgtgtgcatcagttggttcaccggggagttc
attctgcgcttcctgtgtgtgaaagacaggtgccacttcctgaggaaggttccaaacatc
atagacctccttgccatcttgcccttctacataactcttctggtggaaagcctgagcggc
agccacaccacccaagagctggaaaatgtaggacgtctggtccaggttttgaggctcctt
agagctctgcgcatgctgaagctgggaaggcattctacaggattgcgctcacttgggatg
acaatcacccagtgctatgaagaagtcggcctactgctcctgtttctatctgtgggaatt
tctatattttcaacaatagaatactttgcagagcaaagcattcctgatacaaccttcaca
agtgttccttgtgcatggtggtgggccacaacatccatgactacagtaggatatggggac
attagaccagacaccacgacaggcaaaatcgtggccttcatgtgtattctatcaggaatc
cttgtcttggccttgcctattgccattattaatgatcgcttctctgcttgttatttcacc
ttgaaactcaaggaagcagctgtgagacagcgtgaagctctcaagaagcttaccaagaat
atagccactgactcatacattagtgttaacctgagggatatctatgcccggagcatcatg
gagatgcttcgattaaagggcagggagagagcgagtactagaagcagtggtggagatgat
ttctggttttaa

DBGET integrated database retrieval system