KEGG   Rattus norvegicus (rat): 60333
Entry
60333             CDS       T01003                                 

Gene name
Msln
Definition
(RefSeq) mesothelin
  KO
K20733  mesothelin
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60333 (Msln)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Others
   Others
    60333 (Msln)
SSDB
Motif
Pfam: Mesothelin B5
Other DBs
NCBI-GeneID: 60333
NCBI-ProteinID: NP_113846
RGD: 69333
Ensembl: ENSRNOG00000019445
UniProt: Q9ERA7
Position
10q12
AA seq 625 aa
MALPTAQPLLGSCGSPICSRSFLLLLLSLGWLPLLQTQTTRTSQEAALLHAVTGTVDFAS
LPTGLFLGLTCDEVSGLSMGHAKELAMAVRQKNIVLQVHQLRCLARRLPKHLTNEELDAL
PLDLLLFLNPAMFPGQQACAHFFSLISKANVNVLPRRSLERQRLLTGALKCQGVYGFQVS
ETDARALGGLACDLPGEFVAKSSEVLLPWLARCGGPLDQGQAKAVREVLRSGRAPYGPPS
TWSVSTLDALQGLLVVLDESIVHSIPKDVITEWLQGISREPSRLGSKWTVTHPRFRRDTE
QKACPPGKEPNVVDENLIFYQNWELEACVDGTLLAGQMDLVNEIPFTYEQLSIFKHKLDK
TYPQGYPESLIKQLGHFFRYVSPEDIRQWNVTSPDTVNTLLKVSKGQKMDAQVIALVACY
LRGGGKLDEDIVKALDNIPLSYLCDFSPQDLHAIPSSVMWLVGLHDLDKCSQRHLGILYQ
KACSAFQNVSGLEYFEKIRTFLGGASREDLRALSQHNVSMDIATFKKLQVDALVGLSVAE
VQKLLGPHIGDLKTEEDKSPVRDWLFRQQQKDLDSLGLGLQGGIPNGYLILDFNVREAFS
SGAPLLGPGFVFAWIPALLSALRLS
NT seq 1878 nt   +upstreamnt  +downstreamnt
atggccttgccaacagcccaacccctgctggggtcctgtggaagccccatctgcagccgc
agctttctactgcttctccttagtcttgggtggttgccacttctgcagacccagactaca
aggacaagccaggaggccgcacttctccatgctgtgaccggcaccgttgactttgccagt
cttcccacaggcctctttcttggcctcacgtgtgatgaggtatctggcctaagcatggga
cacgccaaggagctggctatggctgtgagacagaagaatatcgtgctccaagtacatcag
ctgcgctgtctggcccgtcgcctccctaagcacctcaccaacgaggaactggatgctctc
ccactggacctgctgctcttcctcaatccagccatgtttccggggcaacaggcttgtgcc
cacttcttctccctcatctctaaagccaatgtaaatgtactcccacggagatctctggag
cgccagaggctgctgaccggggctctgaaatgccagggtgtgtatggatttcaagtgagt
gagacggatgcacgggctctcggaggcctggcctgtgacctgcctggggaattcgtggcc
aaatcttcggaagtcctcctcccctggctggcaagatgcggaggacccctggaccaaggc
caggcaaaggctgtcagggaggttctgaggagtggaagagccccctatggtcccccatcg
acgtggtcagtctccaccctggatgccctgcagggtttgctggtagtgttggatgagtcc
attgtccacagcatccctaaggatgttatcactgaatggctgcaaggcatctccagagag
ccctccaggctggggtctaagtggactgtcacacacccaaggttccggcgggacacagaa
cagaaagcctgccctccagggaaggagcctaacgtggtggatgaaaacctcatcttctac
cagaattgggagctggaggcttgtgtcgatggtaccctgctggccggccagatggacctt
gtgaatgaaattccctttacctacgagcagctcagcatcttcaagcacaaactggacaag
acctacccacaaggctatcccgagtccctgatcaagcagctgggccacttcttcagatac
gttagccctgaggacatccggcagtggaatgtgacttcaccagacacagtgaatactctg
cttaaagtcagcaaaggacaaaagatggatgctcaggtgattgccttggtcgcctgctat
cttcggggaggaggcaagctggacgaggacatagtaaaagccctggacaacatcccctta
agttacctatgtgacttcagcccccaggatctgcacgctataccctccagtgttatgtgg
ctggttgggctccatgacctggacaagtgcagccagaggcatctgggtatcctctatcag
aaggcctgctcagccttccagaacgtgagcgggctggaatactttgagaaaatcaggaca
tttctgggtggggcctccagggaggacctgcgggccctcagccagcacaatgtgagtatg
gacatagccactttcaagaagctgcaggtggatgccctggtggggctgagtgtggctgag
gtacagaaacttctagggccacacattggggacctgaagactgaggaggataaaagccct
gtccgggactggctcttccgacagcagcagaaagacctggacagtctgggtttgggactt
cagggtggcatccccaatggctacctgatcctagacttcaatgtccgagaggccttctcc
agtggagccccactccttgggccaggatttgtgtttgcatggattccagctctgctctca
gctttaagactgagctga

DBGET integrated database retrieval system