KEGG   Rattus norvegicus (rat): 60334Help
Entry
60334             CDS       T01003                                 

Gene name
Ensa
Definition
(RefSeq) endosulfine alpha
Organism
rno  Rattus norvegicus (rat)
SSDB OrthologParalogGFIT
Motif
Pfam: Endosulfine Ntox30 MAS20
Motif
Other DBs
NCBI-GeneID: 60334
NCBI-ProteinID: NP_068614
RGD: 62007
Ensembl: ENSRNOG00000048617
UniProt: P60841
Position
2q34
AA seq 121 aa AA seqDB search
MSQKQEEENPAEETGEEKQDTQEKEGILPEKAEEAKLKAKYPSLGQKPGGSDFLMKRLQK
GQKYFDSGDYNMAKAKMKNKQLPSAGADKNLVTGDHIPTPQDLPQRKSSLVTSKLAGGQV
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atgtcccagaaacaagaagaagaaaaccctgcggaggaaaccggcgaggagaagcaggat
acacaggagaaagaaggtattcttcctgagaaagctgaggaagcaaagctaaaggccaaa
tatccaagcctaggacaaaagcctggaggctccgacttcctcatgaagagactccagaaa
gggcaaaagtactttgactcaggagactacaacatggccaaagccaagatgaagaacaag
cagctaccgagtgcaggagcagacaagaacctggtgaccggtgaccacatccccacccca
caggacctgccccagagaaagtcctcgctcgtcaccagcaagcttgcgggtggccaagtt
gaatga

DBGET integrated database retrieval system