KEGG   Rattus norvegicus (rat): 60337Help
Entry
60337             CDS       T01003                                 

Gene name
Npff
Definition
(RefSeq) neuropeptide FF-amide peptide precursor
  KO
K05247  neuropeptide FF-amide peptide
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    60337 (Npff)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NPFF
Motif
Other DBs
NCBI-GeneID: 60337
NCBI-ProteinID: NP_072108
RGD: 62033
Ensembl: ENSRNOG00000047739
UniProt: Q9WVA9
Position
7q36
AA seq 114 aa AA seqDB search
MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMR
VLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggattccaagtgggctgctgtgctgctgctactgctgctgctgaggaactggggccac
gctgaagaggcagggagctggggtgaagaccaagtctttgcagaagaagataagggaccc
cacccatcacagtatgcccacactccagacaggatccagactcctgggtccctcatgcgt
gttctgctccaggccatggagagacctagaaggaacccagccttcttgtttcagccccag
aggtttggcagaaatgcttgggggccctggagcaaggagcagctaagtccccaggctaga
gagttctggagcctggccgctcctcagcgctttgggaagaagtaa

DBGET integrated database retrieval system