KEGG   Rattus norvegicus (rat): 60341
Entry
60341             CDS       T01003                                 

Gene name
Camkk1
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase kinase 1
  KO
K00908  calcium/calmodulin-dependent protein kinase kinase 1 [EC:2.7.11.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09165 Substance dependence
   05034 Alcoholism
    60341 (Camkk1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    60341 (Camkk1)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     60341 (Camkk1)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: Other
  CAMKK family
   60341 (Camkk1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 60341
NCBI-ProteinID: NP_113850
RGD: 62023
Ensembl: ENSRNOG00000018242
UniProt: P97756
Structure
PDB: 
1CKK

Position
10q24
AA seq 505 aa
MERSPAVCCQDPRAELVERVAAISVAHLEEAEEGPEPASNGVDPPPRARAASVIPGSASR
PTPVRPSLSARKFSLQERPAGSCLEAQVGPYSTGPASHMSPRAWRRPTIESHHVAISDTE
DCVQLNQYKLQSEIGKGAYGVVRLAYNEREDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQ
APQGGPAKQLLPLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVME
VPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQF
EGNDAQLSSTAGTPAFMAPEAISDTGQSFSGKALDVWATGVTLYCFVYGKCPFIDEYILA
LHRKIKNEAVVFPEEPEVSEELKDLILKMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSE
EEHCSVVEVTEEEVKNSVKLIPSWTTVILVKSMLRKRSFGNPFEPQARREERSMSAPGNL
LLKEGCGEGGKSPELPGVQEDEAAS
NT seq 1518 nt   +upstreamnt  +downstreamnt
atggagcgcagtccagccgtctgctgccaagaccctcgagcggaactggtagagcgggtg
gcagccatcagtgtggcccacctagaagaggcagaggagggcccagagcctgccagcaat
ggtgtggaccccccaccccgggccagagctgcctctgtgatccctggcagtgcttcaaga
cccacaccagtgcgtcccagcctctctgctagaaagttctccctgcaggaaagaccagcg
ggaagctgtctagaggctcaggttgggccttactctacaggacctgccagtcacatgtct
cctcgggcttggcggagacccaccatcgagtcccaccatgtggccatctcagacacagag
gactgtgtgcaactgaaccagtacaagctgcagagtgagattggcaagggtgcctatggt
gtggtgaggctggcctacaatgaaagggaagacagacactatgcaatgaaagttctttcc
aaaaagaagttactgaagcagtatggctttcctcgccgtcctcccccgagagggtcccaa
gctcctcagggagggccagccaaacagctgctgcccctggagcgtgtataccaggagatt
gccattttaaagaaactggaccacgtgaatgtagtcaagttgatcgaggtcctggatgat
cctgctgaagacaatctctatttggtgtttgacctcctgagaaagggaccagtcatggaa
gtgccctgcgacaagcccttcccagaggagcaagctcgcctctacctccgggacatcatc
ctgggcctcgagtacttgcactgccagaagattgtgcacagggacatcaagccgtccaat
ctgctccttggggacgatgggcacgtgaagatcgccgactttggtgtcagcaaccagttt
gaggggaatgatgctcagctgtccagtacggcagggaccccagcattcatggccccggag
gccatctctgacaccggccagagcttcagtgggaaggccttggatgtatgggccactggg
gttacactgtattgttttgtctacgggaagtgcccattcattgatgagtacatcctggcc
ctgcacagaaagatcaagaatgaggccgtggtgttccctgaggagccggaggtcagcgag
gaactcaaagacctgatcctgaagatgctagacaagaatcctgaaacaagaattggggtg
tctgatatcaagttacacccttgggtgaccaagcatggagaggagcccctcccttcagag
gaggaacactgcagtgtggtagaggtgactgaggaggaggtgaagaactcagtcaagctc
atccccagctggaccactgtgatcctggtcaagtctatgctgagaaagcgttcctttgga
aacccatttgagccccaagcacgcagggaagaaagatctatgtctgcgccaggaaactta
ctgttgaaagaaggatgtggagaagggggcaaaagcccagagcttcccggagtccaggaa
gatgaggctgcatcctga

DBGET integrated database retrieval system