KEGG   Rattus norvegicus (rat): 60350
Entry
60350             CDS       T01003                                 

Gene name
Cd14
Definition
(RefSeq) monocyte differentiation antigen CD14 precursor
  KO
K04391  monocyte differentiation antigen CD14
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04064  NF-kappa B signaling pathway
rno04145  Phagosome
rno04620  Toll-like receptor signaling pathway
rno04640  Hematopoietic cell lineage
rno05132  Salmonella infection
rno05133  Pertussis
rno05134  Legionellosis
rno05146  Amoebiasis
rno05152  Tuberculosis
rno05202  Transcriptional misregulation in cancer
rno05221  Acute myeloid leukemia
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60350 (Cd14)
   04064 NF-kappa B signaling pathway
    60350 (Cd14)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    60350 (Cd14)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    60350 (Cd14)
   04620 Toll-like receptor signaling pathway
    60350 (Cd14)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    60350 (Cd14)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    60350 (Cd14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    60350 (Cd14)
   05133 Pertussis
    60350 (Cd14)
   05134 Legionellosis
    60350 (Cd14)
   05152 Tuberculosis
    60350 (Cd14)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    60350 (Cd14)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    60350 (Cd14)
   04090 CD molecules [BR:rno04090]
    60350 (Cd14)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
    60350 (Cd14)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   60350 (Cd14)
CD molecules [BR:rno04090]
 Proteins
  60350 (Cd14)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:rno00537]
 Receptors
  60350 (Cd14)
SSDB
Motif
Pfam: LRR_8 LRR_4
Other DBs
NCBI-GeneID: 60350
NCBI-ProteinID: NP_068512
RGD: 620588
Ensembl: ENSRNOG00000017819
UniProt: Q63691
Position
18
AA seq 372 aa
MKLMLGLLLLPLTLVHASPATPEPCELDQDEESVRCYCNFSDPQPNWSSAFLCAGAEDVE
FYGGGRSLEYLLKRVDTEANLGQYTDIIRSLPLKRLTVRSARVPTQILFGTLRVLGYSGL
RELTLENLEVTGTALSPLLDATGPDLNTLSLRNVSWATTDTWLAELQQWLKPGLKVLSIA
QAHSLNFSCKQVGVFPALATLDLSDNPELGEKGLISALCPHKFPTLQVLALRNAGMETTS
GVCSALAAARVPLQALDLSHNSLRDTAGTPSCDWPSQLNSLNLSFTGLEHVPKGLPAKLS
VLDLSYNRLDRKPRPEELPEVGSLSLTGNPFLHSESQSEAYNSGVVIATALSPGSAGLSG
TLALLLGHRLFV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaagcttatgctcggcttgttgctgttgcctttgacactggtgcatgcctctcccgcc
acaccagaaccctgtgagctggaccaggacgaggaaagtgtccgctgctactgcaacttc
tcagatccgcagcccaattggtccagcgcttttctatgcgcgggggcggaagacgtggag
ttctacggcggcggtcgcagcctggagtaccttctaaagcgtgtggacacggaagcaaat
ctggggcagtacactgatattatcaggtctctgcccttgaagaggcttactgtgcggtcc
gcgcgggttcctactcagattctattcggaaccctgcgtgtgctcggatattctggcctc
cgggaactgactcttgaaaacctcgaggtaaccggcaccgcgctttcgccgcttctggat
gccaccggacccgatctcaacaccttgagcctccgcaacgtgtcgtgggcaacaacggat
acctggctcgcagaactgcagcagtggctaaagcctggactcaaggtactaagtattgcc
caagcacactcactcaacttttcttgcaaacaggtcggcgtcttccctgcccttgccacc
ttagatctgtctgacaaccctgagttgggcgagaaaggactgatctcggccctctgtccg
cacaaattcccgaccctccaagttttagcgctgcgcaacgcggggatggagacgaccagc
ggcgtgtgctctgcgctggccgcagcaagagtgccactgcaggcactggatctcagtcac
aattcactgcgggatactgctggcactccgagctgtgactggcccagtcagctaaactcg
ctcaatctatctttcactgggctggagcacgtacctaaagggctgccagccaagcttagc
gtgcttgatctcagttacaacaggctggataggaaacctaggccagaggagctgcctgaa
gtggggagcctgtcacttacaggaaatccctttttgcactctgaatcccagtcggaggcg
tataactctggcgtagtcatagccacagctctttcacccggatcagcgggcttgtcagga
actttggctttgctcctaggacatcgcctctttgtttaa

DBGET integrated database retrieval system