KEGG   Rattus norvegicus (rat): 60351Help
Entry
60351             CDS       T01003                                 

Gene name
Nr1h4, Fxr
Definition
(RefSeq) nuclear receptor subfamily 1, group H, member 4
  KO
K08537  farnesoid X receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    60351 (Nr1h4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    60351 (Nr1h4)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:rno03310]
    60351 (Nr1h4)
Transcription factors [BR:rno03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    60351 (Nr1h4)
Nuclear receptors [BR:rno03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   60351 (Nr1h4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 60351
NCBI-ProteinID: NP_068513
RGD: 628831
Ensembl: ENSRNOG00000007197
UniProt: Q62735
Structure
PDB: 

Position
7q13
AA seq 469 aa AA seqDB search
MNLIGPSHLQATDEFALSENLFGVLTEHAAGPLGQNLDLESYSPYNNVQFPQVQPQISSS
SYYSNLGFYPQQPEDWYSPGLYELRRMPTESVYQGETEVSEMPVTKKPRMAASSAGRIKG
DELCVVCGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQDCR
LRKCREMGMLAECLLTEIQCKSKRLRKNVKQHADQTVNEDSEGRDLRQVTSTTKLCREKT
ELTVDQQTLLDYIMDSYSKQRMPQEITNKILKEEFSAEENFLILTEMATSHVQILVEFTK
RLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPAGHADLLEERIRKSGISDEYIT
PMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQEPLLDVLQKLCKIYQ
PENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgattgggccctcccatttacaagccacggacgagtttgctctttctgaaaac
ttatttggagtgctaacagagcacgcggcaggtcctctggggcagaatctggacttggaa
tcgtactccccatacaacaatgtgcagtttcctcaagttcagccacagatctcctcctcg
tcctattattccaacctgggtttctacccgcaacaaccggaagactggtactctcctgga
ctctatgaactcaggcgaatgcccactgagagtgtgtaccagggagagactgaggtatcc
gagatgcctgtgacaaagaagccgcgaatggccgcctcatcggcgggaagaataaaaggg
gatgagctgtgtgtggtctgcggagacagggcctctgggtaccattacaacgcgctcacc
tgcgagggctgcaaaggtttcttccgaagaagcatcaccaaaaacgccgtgtacaagtgt
aagaacgggggcaactgcgtgatggatatgtacatgcgtcggaagtgccaggattgccgg
ctaaggaagtgcagagagatgggaatgttggctgaatgtttgttaactgaaattcagtgt
aaatctaaacggctaaggaaaaatgtgaagcagcatgcggatcagacagtgaatgaggac
agcgaagggcgtgacttgcggcaagtgacctccacgaccaagctatgcagggagaaaact
gaactcactgtagaccagcagaccctcctggattatattatggactcatacagcaaacag
agaatgccacaggagatcacaaataaaatcttaaaagaagaatttagtgcagaagaaaat
tttctcatattaacagaaatggctaccagtcacgtacagattctcgtagaattcacaaaa
agacttccagggtttcagacactggaccacgaagaccagattgctttgctcaaagggtcc
gcagtcgaggccatgttccttcgttcagcggagattttcaataagaaacttcctgccgga
cacgcagacctgttggaagaaagaattcgaaagagcggcatctccgatgagtacataacc
ccgatgtttagtttctataaaagtgtcggggagctgaaaatgacccaggaagagtacgct
ctgctcacagcaattgtcatcctctctccagacagacaatacataaaggatagagaggca
gtggagaagcttcaggagcctctgctcgatgtcctacaaaaactctgcaagatctaccag
cccgagaaccctcagcatttcgcctgcctcctgggtcgcctgacagaactccggacattc
aaccatcaccacgctgagatgctgatgtcttggagggtgaatgaccacaagttcaccccg
ctcctctgtgagatctgggatgtgcagtga

DBGET integrated database retrieval system