KEGG   Rattus norvegicus (rat): 60352Help
Entry
60352             CDS       T01003                                 

Gene name
Mapk12, Sapk3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05132  Salmonella infection
rno05133  Pertussis
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05160  Hepatitis C
rno05164  Influenza A
rno05167  Kaposi's sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05205  Proteoglycans in cancer
rno05418  Fluid shear stress and atherosclerosis
Module
rno_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    60352 (Mapk12)
   04010 MAPK signaling pathway
    60352 (Mapk12)
   04370 VEGF signaling pathway
    60352 (Mapk12)
   04668 TNF signaling pathway
    60352 (Mapk12)
   04068 FoxO signaling pathway
    60352 (Mapk12)
   04071 Sphingolipid signaling pathway
    60352 (Mapk12)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    60352 (Mapk12)
   04218 Cellular senescence
    60352 (Mapk12)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    60352 (Mapk12)
 Organismal Systems
  Immune system
   04611 Platelet activation
    60352 (Mapk12)
   04620 Toll-like receptor signaling pathway
    60352 (Mapk12)
   04621 NOD-like receptor signaling pathway
    60352 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    60352 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    60352 (Mapk12)
   04660 T cell receptor signaling pathway
    60352 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    60352 (Mapk12)
   04659 Th17 cell differentiation
    60352 (Mapk12)
   04657 IL-17 signaling pathway
    60352 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    60352 (Mapk12)
   04670 Leukocyte transendothelial migration
    60352 (Mapk12)
  Endocrine system
   04912 GnRH signaling pathway
    60352 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    60352 (Mapk12)
   04917 Prolactin signaling pathway
    60352 (Mapk12)
   04926 Relaxin signaling pathway
    60352 (Mapk12)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    60352 (Mapk12)
  Nervous system
   04728 Dopaminergic synapse
    60352 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    60352 (Mapk12)
   04722 Neurotrophin signaling pathway
    60352 (Mapk12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    60352 (Mapk12)
  Development
   04380 Osteoclast differentiation
    60352 (Mapk12)
  Environmental adaptation
   04714 Thermogenesis
    60352 (Mapk12)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    60352 (Mapk12)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    60352 (Mapk12)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    60352 (Mapk12)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    60352 (Mapk12)
  Infectious diseases
   05132 Salmonella infection
    60352 (Mapk12)
   05133 Pertussis
    60352 (Mapk12)
   05152 Tuberculosis
    60352 (Mapk12)
   05164 Influenza A
    60352 (Mapk12)
   05160 Hepatitis C
    60352 (Mapk12)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    60352 (Mapk12)
   05169 Epstein-Barr virus infection
    60352 (Mapk12)
   05145 Toxoplasmosis
    60352 (Mapk12)
   05140 Leishmaniasis
    60352 (Mapk12)
   05142 Chagas disease (American trypanosomiasis)
    60352 (Mapk12)
  Drug resistance
   01522 Endocrine resistance
    60352 (Mapk12)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     60352 (Mapk12)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   60352 (Mapk12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like UvrD_C
Motif
Other DBs
NCBI-GeneID: 60352
NCBI-ProteinID: NP_068514
RGD: 70975
Ensembl: ENSRNOG00000031233
UniProt: Q63538
Position
7q34
AA seq 367 aa AA seqDB search
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
VTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctgctggatgtgttcactcccgatgagactctggat
gacttcacagacttctacctggtgatgccattcatgggcactgacctgggcaagctcatg
aagcacgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaagggg
ctgaagtatatccacgctgccggcgtcatccacagggacttgaaacctggaaacctggct
gtgaacgaggactgtgagctgaagatcctagattttggccttgccaggcaggcggacagt
gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgttacacacagacagtggacatttggtctgttggctgcatcatggcagagatgatt
actggaaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaaa
gtcacagggacaccccctcctgagtttgtacagaagctacagagtgctgaggccaagaac
tacatggaaggcctccctgagttggaaaagaaggattttgcttctgtcctgaccaatgca
agccctcaggccgtgaatctcctggaaaagatgctggtgttggatgcggaacagcgggtg
acagcagctgaggcattagcccacccatactttgagtcccttcgggacactgaggatgag
cccaaggcccagaaatatgatgactcctttgatgacgtagaccgcacccttgaggaatgg
aagcgtgttacgtataaggaagtgctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacagctctgtga

DBGET integrated database retrieval system