KEGG   Rattus norvegicus (rat): 60352Help
Entry
60352             CDS       T01003                                 

Gene name
Mapk12, Sapk3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno01522  Endocrine resistance
rno04010  MAPK signaling pathway
rno04015  Rap1 signaling pathway
rno04068  FoxO signaling pathway
rno04071  Sphingolipid signaling pathway
rno04114  Oocyte meiosis
rno04218  Cellular senescence
rno04261  Adrenergic signaling in cardiomyocytes
rno04370  VEGF signaling pathway
rno04380  Osteoclast differentiation
rno04550  Signaling pathways regulating pluripotency of stem cells
rno04611  Platelet activation
rno04620  Toll-like receptor signaling pathway
rno04621  NOD-like receptor signaling pathway
rno04622  RIG-I-like receptor signaling pathway
rno04625  C-type lectin receptor signaling pathway
rno04657  IL-17 signaling pathway
rno04658  Th1 and Th2 cell differentiation
rno04659  Th17 cell differentiation
rno04660  T cell receptor signaling pathway
rno04664  Fc epsilon RI signaling pathway
rno04668  TNF signaling pathway
rno04670  Leukocyte transendothelial migration
rno04714  Thermogenesis
rno04722  Neurotrophin signaling pathway
rno04723  Retrograde endocannabinoid signaling
rno04728  Dopaminergic synapse
rno04750  Inflammatory mediator regulation of TRP channels
rno04912  GnRH signaling pathway
rno04914  Progesterone-mediated oocyte maturation
rno04917  Prolactin signaling pathway
rno04926  Relaxin signaling pathway
rno04933  AGE-RAGE signaling pathway in diabetic complications
rno05014  Amyotrophic lateral sclerosis (ALS)
rno05132  Salmonella infection
rno05133  Pertussis
rno05135  Yersinia infection
rno05140  Leishmaniasis
rno05142  Chagas disease (American trypanosomiasis)
rno05145  Toxoplasmosis
rno05152  Tuberculosis
rno05161  Hepatitis B
rno05163  Human cytomegalovirus infection
rno05167  Kaposi sarcoma-associated herpesvirus infection
rno05169  Epstein-Barr virus infection
rno05170  Human immunodeficiency virus 1 infection
rno05205  Proteoglycans in cancer
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
rno05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    60352 (Mapk12)
   04010 MAPK signaling pathway
    60352 (Mapk12)
   04370 VEGF signaling pathway
    60352 (Mapk12)
   04668 TNF signaling pathway
    60352 (Mapk12)
   04068 FoxO signaling pathway
    60352 (Mapk12)
   04071 Sphingolipid signaling pathway
    60352 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    60352 (Mapk12)
   04218 Cellular senescence
    60352 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    60352 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    60352 (Mapk12)
   04620 Toll-like receptor signaling pathway
    60352 (Mapk12)
   04621 NOD-like receptor signaling pathway
    60352 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    60352 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    60352 (Mapk12)
   04660 T cell receptor signaling pathway
    60352 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    60352 (Mapk12)
   04659 Th17 cell differentiation
    60352 (Mapk12)
   04657 IL-17 signaling pathway
    60352 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    60352 (Mapk12)
   04670 Leukocyte transendothelial migration
    60352 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    60352 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    60352 (Mapk12)
   04917 Prolactin signaling pathway
    60352 (Mapk12)
   04926 Relaxin signaling pathway
    60352 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    60352 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    60352 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    60352 (Mapk12)
   04722 Neurotrophin signaling pathway
    60352 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    60352 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    60352 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    60352 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    60352 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    60352 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    60352 (Mapk12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    60352 (Mapk12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    60352 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    60352 (Mapk12)
   05135 Yersinia infection
    60352 (Mapk12)
   05133 Pertussis
    60352 (Mapk12)
   05152 Tuberculosis
    60352 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60352 (Mapk12)
   05161 Hepatitis B
    60352 (Mapk12)
   05163 Human cytomegalovirus infection
    60352 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    60352 (Mapk12)
   05169 Epstein-Barr virus infection
    60352 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    60352 (Mapk12)
   05140 Leishmaniasis
    60352 (Mapk12)
   05142 Chagas disease (American trypanosomiasis)
    60352 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    60352 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    60352 (Mapk12)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     60352 (Mapk12)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   60352 (Mapk12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Haspin_kinase Kinase-like UvrD_C
Motif
Other DBs
NCBI-GeneID: 60352
NCBI-ProteinID: NP_068514
RGD: 70975
Ensembl: ENSRNOG00000031233
UniProt: Q63538
Position
7q34
AA seq 367 aa AA seqDB search
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
VTGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaggacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctgctggatgtgttcactcccgatgagactctggat
gacttcacagacttctacctggtgatgccattcatgggcactgacctgggcaagctcatg
aagcacgagactctgagtgaagacagaatccagtttcttgtgtatcagatgctgaagggg
ctgaagtatatccacgctgccggcgtcatccacagggacttgaaacctggaaacctggct
gtgaacgaggactgtgagctgaagatcctagattttggccttgccaggcaggcggacagt
gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgttacacacagacagtggacatttggtctgttggctgcatcatggcagagatgatt
actggaaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaaa
gtcacagggacaccccctcctgagtttgtacagaagctacagagtgctgaggccaagaac
tacatggaaggcctccctgagttggaaaagaaggattttgcttctgtcctgaccaatgca
agccctcaggccgtgaatctcctggaaaagatgctggtgttggatgcggaacagcgggtg
acagcagctgaggcattagcccacccatactttgagtcccttcgggacactgaggatgag
cccaaggcccagaaatatgatgactcctttgatgacgtagaccgcacccttgaggaatgg
aagcgtgttacgtataaggaagtgctcagcttcaagcctcccaggcagctaggagccaga
gttccaaaggagacagctctgtga

DBGET integrated database retrieval system