KEGG   Rattus norvegicus (rat): 60376
Entry
60376             CDS       T01003                                 

Gene name
Plrg1
Definition
(RefSeq) pleiotropic regulator 1
  KO
K12862  pleiotropic regulator 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    60376 (Plrg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    60376 (Plrg1)
   03400 DNA repair and recombination proteins [BR:rno03400]
    60376 (Plrg1)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    60376 (Plrg1)
 Complex C
   Prp19-CDC5 complex
    60376 (Plrg1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   PSO4 complex
    60376 (Plrg1)
SSDB
Motif
Pfam: WD40 ANAPC4_WD40 Nucleoporin_N DUF5832
Other DBs
NCBI-GeneID: 60376
NCBI-ProteinID: NP_068525
RGD: 621047
Ensembl: ENSRNOG00000006655
Vega: OTTRNOG00000001388
UniProt: Q9WUC8
Position
2
AA seq 514 aa
MVEEVQKHSVHTLVFRSLKRTHDMFVADNGKPVPLDEESHKRKMAIKLRNEYGPVLHMPT
SKENLKEKGPQNAPDSYPHKQYPANQGQDVEYLVTGTHPYPPGPGVALTADTKIQRMPSE
SAAQSLAVALPSQTRVDANRTAPAGSEYRHPGASDRSQPTAMNSMIMETSNTKNSALMAK
KAPTMPKPQWHPPWKLYRVISGHLGWVRCIAVEPGNQWFVTGSADRTIKIWDLASGKLKL
SLTGHISTVRGVIVSTRSPYLFSCGEDKQVKCWDLEYNKVIRHYHGHLSAVYGLDLHPTI
DVLVTCSRDSTARIWDVRTKASVHTLSGHTNAVATVRCQAAEPQIITGSHDTTIRLWDLV
AGKTRVTLTNHKKSVRAVVLHPLHYTFASGSPDNIKQWKFPDGGFIQNLSGHNAIINTLA
VNTDGVLVSGADNGTMHLWDWRTGYNFQRVHAAVQPGSLDSESGIFACAFDRSESRLLTA
EADKTIKVYREDETATEETHPVSWKPEIIKRKRF
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggtggaggaggtacagaagcattctgtgcacacactagtgttcaggtcattgaagagg
acccatgacatgtttgtggctgataatggaaaacctgtgcctttggatgaagagagtcac
aagcggaaaatggcaatcaagcttcgtaatgagtatggccctgtgctgcatatgcctact
tcaaaagagaatcttaaggagaagggacctcaaaacgcaccagattcatatcctcataag
cagtatcctgccaatcaaggacaagatgttgaatatttggtgacaggtacacatccatat
ccaccaggacctggtgttgccttgactgctgatactaagatccaaagaatgccaagcgag
tcagccgcacagtccttagctgtggcgttaccgtctcagaccagagttgatgcaaatcgg
actgcgcctgctggaagtgaataccgacacccaggggcttctgaccgttcccagcccaca
gcaatgaattctatgattatggagaccagcaataccaagaactctgcattaatggctaaa
aaagcccctacaatgcccaaaccccagtggcacccaccgtggaaactctacagggttatc
agtgggcatcttggctgggttcggtgtattgctgtggaacctggaaatcagtggttcgtt
actggatctgctgacagaactataaagatttgggacttggccagtggcaaattaaagctg
tcattgactggccacatcagcacagtacgcggtgtgattgtgagcacgaggagcccttac
ttgttctcttgtggagaagacaaacaagtgaagtgttgggatcttgaatataacaaggtt
atacggcactatcatggccatctaagtgcagtgtatggtctggatttgcatccaacaatc
gatgtcctggtcacttgtagtcgagattctactgctcggatctgggatgtgagaactaaa
gccagtgtgcacactttgtctggacacacaaatgcagttgctaccgtgagatgccaagct
gcagagccacaaattattactggaagtcacgataccacaatacgattatgggatctggtg
gctggaaagacacgagtcacattgacgaatcataagaagtcagtcagggctgtggtctta
catccgctacattacacatttgcatctggttctccagataacataaagcagtggaaattc
cctgacggaggcttcattcagaatctctctgggcacaatgcaattattaacacgctggca
gtcaatacggatggagtacttgtatctggagctgacaatggcactatgcacctttgggac
tggagaactggctataattttcagcgcgttcatgctgctgtacagcctgggtctttggac
agtgaatcaggaatattcgcttgtgcttttgatcggtcagaaagtcggttactaacagct
gaagctgataaaaccattaaagtttacagagaggatgagactgcgacagaagaaactcac
ccagtcagctggaaaccagaaattatcaagagaaagagattttag

DBGET integrated database retrieval system