KEGG   Rattus norvegicus (rat): 60383Help
Entry
60383             CDS       T01003                                 

Gene name
Rbck1, HOIL-1, Pkcbpb15
Definition
(RefSeq) RANBP2-type and C3HC4-type zinc finger containing 1
  KO
K10630  RanBP-type and C3HC4-type zinc finger-containing protein 1 [EC:2.3.2.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04217  Necroptosis
rno04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    60383 (Rbck1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    60383 (Rbck1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rno04121]
    60383 (Rbck1)
Enzymes [BR:rno01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.31  RBR-type E3 ubiquitin transferase
     60383 (Rbck1)
Ubiquitin system [BR:rno04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   RBR proteins
    60383 (Rbck1)
  Multi subunit Ring-finger type E3
   LUBAC complex
    60383 (Rbck1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-RING_UBOX IBR zf-RING_2 zf-RING_5 zf-C3HC4_2 zf-C3HC4 zf-RanBP zf-C3HC4_4 ubiquitin zf-RING_11 Secretin
Motif
Other DBs
NCBI-GeneID: 60383
NCBI-ProteinID: NP_068532
RGD: 708404
Ensembl: ENSRNOG00000006695
UniProt: Q62921
Position
3q41
AA seq 508 aa AA seqDB search
MDEKTKKAEEMALSLARAVTGGDEQAAIKYATWLAEQKVPLRVQVKPEVSPTQDIRLCVS
VEDAYMHTVTIWLTVRPDMTVASLKDMVFLDYGFPPSLQQWVVGQRLARDQETLHSHGIR
RNGDSAYLYLLSARNTSLNPQELQRQRQLRMLEDLGFKDLTLQPRGPLEPVLPKPRTHQE
TGQPDAAPESPPVGWQCPGCTFINKPTRPGCEMCCRARPEAYQIPASYQPDEEERARLAG
EEEALRQYEQRKQQQQEGNYLQHVQLEQRSLVLNTEPAECPVCYSVLAPGEAVVLRECLH
TFCRECLQGTIRNSQEAEVSCPFIDNTYSCPGKLLEREIRALLSPEDYQRFLDLGVSIAE
NRSTLSYHCKTPDCRGWCFFEDDVNEFTCPVCTRVNCLLCKAIHERMNCREYQDDLAHRA
RNDVAAQQTTEMLRVMLQQGEAMYCPQCRIVVQKKDGCDWIRCTVCHTEICWVTKGPRWG
PGGPGDTSGGCRCRVNGIPCHPSCQNCH
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggacgagaagaccaagaaagcagaggagatggccctgagccttgcccgggcagtgact
ggcggagatgaacaggctgcaatcaagtatgccacctggctggcagagcagaaggtaccc
ctcagggtgcaagtaaaacccgaggtttccccaacacaagacatcaggctttgtgtgagt
gtggaagatgcttacatgcacactgtcaccatttggctcacagtacgccctgatatgaca
gtggcctcccttaaggacatggtattcctggactatggctttccacccagcctgcagcag
tgggtggttggacagaggctggcacgagaccaggagaccttgcattcacatggcattcga
cggaatggagacagtgcttatctctacctgctgtcagcccgcaacacatcactcaaccct
caagagctgcagcggcagcggcagctgcgcatgttggaagatttgggcttcaaggacctc
accctgcagccacggggtcccttggaacctgtccttcccaagcccaggacccaccaggag
acggggcagccagatgcagccccagagtcaccaccggtgggctggcagtgccctggctgc
acgttcatcaacaaacccacacggcctgggtgtgagatgtgctgccgtgcaaggcctgag
gcctaccagatccctgcctcgtaccagcctgatgaggaggagcgagcacgcctggctggt
gaggaggaggcgctgcgccagtatgagcagcggaaacagcagcagcaggaggggaactac
ctgcagcacgtgcagctggagcagaggagcctggtgctgaacaccgaacctgctgagtgc
cctgtgtgctactcagtgctggcacccggtgaggccgtggtgctgcgtgagtgtctgcac
accttctgcagggagtgcctgcagggtaccatccgaaacagccaggaggcggaggtatcc
tgccccttcattgacaacacctactcatgccctggcaagctgctggagagggagatccgg
gcgctcctgtcccctgaggactaccagcgtttcctggacctgggtgtgtccatcgcagag
aatcgaagcaccttgagctaccactgcaagacccccgactgcaggggctggtgcttcttt
gaggatgacgtcaacgagttcacctgtcctgtgtgcacccgcgtcaactgtctgctctgc
aaggccatccacgagcgcatgaattgcagagagtaccaggatgacctggcccatcgggct
cggaatgatgtggctgcccagcagacaactgagatgctgagggtgatgctgcagcaaggc
gaggccatgtactgcccacagtgccggattgtggtgcagaagaaggatggctgtgactgg
atccgctgtactgtctgccacactgagatctgctgggtcaccaagggtccacgctggggc
cctgggggcccaggggacaccagtggtggctgccgctgccgggtcaatgggattccatgc
catccaagctgtcaaaactgccactaa

DBGET integrated database retrieval system