KEGG   Rattus norvegicus (rat): 60391Help
Entry
60391             CDS       T01003                                 

Gene name
Nrxn1, Nrxn1b
Definition
(RefSeq) neurexin 1
  KO
K07377  neurexin
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    60391 (Nrxn1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60391 (Nrxn1)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    60391 (Nrxn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Laminin_G_2 Laminin_G_1 Laminin_G_3 EGF Syndecan hEGF DUF202
Motif
Other DBs
NCBI-GeneID: 60391
NCBI-ProteinID: NP_068535
RGD: 628659
UniProt: Q63372
Structure
PDB: 

Position
6q12
AA seq 1507 aa AA seqDB search
MGTALVQHGGCCLLCLSLLLLGCWAELGSGLEFPGAEGQWTRFPKWNACCESEMSFQLKT
RSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIR
RQFRNTTLYIDRAEAKWVEVKSKRRDMTVFSGLFVGGLPPELRAAALKLTLASVREREPF
KGWIRDVRVNSSQALPVDGSEVKLDEEPPNSGGGSPCEAGDEGDGGVCLNGGVCSVVDDQ
AVCDCSRTGFRGKDCSQEDNNVEGLAHLMMGDQGKSKGKEEYIATFKGSEYFCYDLSQNP
IQSSSDEITLSFKTLQRNGLMLHTGKSADYVNLALKNGAVSLVINLGSGAFEALVEPVNG
KFNDNAWHDVKVTRNLRQHSGIGHAMVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSP
STADLPGSPVSNNFMGCLKEVVYKNNDVRLELSRLAKQGDPKMKIHGVVAFKCENVATLD
PITFETPESFISLPKWNAKKTGSISFDFRTTEPNGLILFSHGKPRHQKDAKHPQMIKVDF
FAIEMLDGHLYLLLDMGSGTIKIKALQKKVNDGEWYHVDFQRDGRSGTISVNTLRTPYTA
PGESEILDLDDELYLGGLPENKAGLVFPTEVWTALLNYGYVGCIRDLFIDGQSKDIRQMA
EIQSTAGVKPSCSRETAKPCLSNPCKNNGMCRDGWNRYVCDCSGTGYLGRSCEREATVLS
YDGSMFMKIQLPVVMHTEAEDVSLRFRSQRAYGILMATTSRDSADTLRLELDAGRVKLTV
NLDCIRINCNSSKGPETLFAGYNLNDNEWHTVRVVRRGKSLKLTVDDQQAMTGQMAGDHT
RLEFHNIETGIITERRYLSSVPSNFIGHLQSLTFNGMAYIDLCKNGDIDYCELNARFGFR
NIIADPVTFKTKSSYVALATLQAYTSMHLFFQFKTTSLDGLILYNSGDGNDFIVVELVKG
YLHYVFDLGNGANLIKGSSNKPLNDNQWHNVMISRDTSNLHTVKIDTKITTQITAGARNL
DLKSDLYIGGVAKETYKSLPKLVHAKEGFQGCLASVDLNGRLPDLISDALFCNGQIERGC
EGPSTTCQEDSCSNQGVCLQQWDGFSCDCSMTSFSGPLCNDPGTTYIFSKGGGQITHKWP
PNDRPSTRADRLAIGFSTVQKEAVLVRVDSSSGLGDYLELHIHQGKIGVKFNVGTDDIAI
EESNAIINDGKYHVVRFTRSGGNATLQVDSWPVIERYPAGNNDNERLAIARQRIPYRLGR
VVDEWLLDKGRQLTIFNSQATIIIGGKEQGQPFQGQLSGLYYNGLKVLNMAAENDANIAI
VGNVRLVGEVPSSMTTESTATAMQSEMSTSIMETTTTLATSTARRGKPPTKEPISQTTDD
ILVASAECPSDDEDIDPCEPSSGGLANPTRVGGREPYPGSAEVIRESSSTTGMVVGIVAA
AALCILILLYAMYKYRNRDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSANKNKKN
KDKEYYV
NT seq 4524 nt NT seq  +upstreamnt  +downstreamnt
atggggacggcgctggtccagcatgggggctgctgtctcctctgcctgtcgctgctgctg
ttgggctgctgggcagagctgggcagtgggctggagttcccaggcgctgagggccagtgg
acgcgcttccccaagtggaacgcgtgctgcgagagtgagatgagcttccagctgaagaca
cgcagcgcccgcggcctcgtgctctacttcgacgacgagggcttctgcgacttcctcgag
ctcatcctgacacgcggcggccgcttgcagctcagcttctccatcttctgcgccgagccc
gccacgctgttggccgacacgccagtcaacgacggcgcctggcacagcgtgcgcatccgc
cgccagttccgcaacaccactctctacatcgaccgcgctgaggccaagtgggtggaggtc
aagtccaagcgcagggacatgacggtgttcagtgggctgttcgtgggcggcctgccgcct
gaactgcgagccgctgcgctcaagctcaccctggcctcggtgcgtgagcgggagcccttc
aagggctggatccgtgatgtcagggtcaactcgtcccaggcgctgccggtggacggcagc
gaggtcaagctggacgaagagccgcccaatagcgggggcgggagcccgtgcgaggcgggc
gatgagggcgacggcggcgtgtgcctcaacgggggcgtgtgctccgtggtcgacgaccag
gccgtgtgtgactgctcgaggaccggtttccgtggcaaagactgcagccaagaagacaac
aatgtagaaggtctggcgcacctgatgatgggcgaccaaggtaaaagtaaaggaaaagaa
gagtatattgccacattcaagggatctgagtacttctgctacgacttatcccaaaacccc
attcaaagcagcagcgacgaaataactctgtcctttaaaactcttcagaggaatggactg
atgcttcacacagggaaatcggctgattatgtcaaccttgccttgaaaaatggagctgtc
tctctggtcattaatttgggatcaggggcctttgaagcgctagtagagcccgtgaatgga
aagtttaatgataatgcctggcatgatgtgaaagtcaccaggaatctgcgtcagcactca
ggcattggacacgctatggtgacaatatcagtggatgggattcttaccacaacgggctac
acgcaagaagattacaccatgctggggtctgatgactttttctatgttggaggcagcccc
agcacagccgaccttccagggtcaccagtcagtaacaactttatgggctgtctcaaagag
gtcgtatataaaaataatgatgtaagactggagttatcgcgacttgccaagcaaggagat
cctaagatgaagatccatggtgtggtggcttttaagtgtgaaaatgtggcaaccttagac
ccaatcacttttgagaccccagaatctttcatttctttgcctaagtggaatgcaaagaaa
acaggctcaatatcatttgatttccgtacaacggagccaaatggcctcatcttgtttagc
catggcaagccaagacatcagaaggatgccaagcacccgcagatgattaaggttgacttt
tttgctattgaaatgctggatggccacttgtacctcctcttagacatgggatcaggtact
ataaaaatcaaagcccttcagaagaaagtcaatgatggagaatggtatcacgtggatttc
cagcgagatggacggtcaggtaccatttctgtcaacacacttcgtactccctacacagct
cccggtgagagtgagatcctagacctcgatgatgagttgtatctgggtggcttgccagaa
aataaggctggcctggtcttccccactgaggtgtggactgctctgctcaactatggctac
gtaggctgcatccgggatctattcattgatggccagagcaaagatatccggcagatggcg
gaaattcagagtactgctggagtgaagccatcctgctcaagggagactgcaaaaccatgc
cttagcaatccttgcaaaaacaatggcatgtgcagggatggctggaacagatacgtctgt
gattgctctggaacaggctatctcggcaggtcctgtgagagagaggcaacggttttgagc
tacgatgggagtatgtttatgaaaattcagctccctgtggtgatgcacactgaggccgag
gacgtttccttacggttcagatcccagcgtgcgtacggcattctgatggcgaccacttct
agagactccgcagatacccttcgactggagctagatgcagggcgcgtgaaactcacggtc
aatctagattgtatcaggattaactgtaattccagcaaaggtcctgagaccctttttgcc
ggctataacctcaatgataatgaatggcacacagtacgtgtggttcggcgaggaaaaagt
ttaaagctaaccgtggatgatcaacaagccatgacaggccaaatggcaggtgatcataca
aggctggagtttcataacatagagacaggcatcatcacagaacgacgctatctttcttct
gtcccctccaacttcattgggcacctgcaaagcctcacatttaatggaatggcatacatt
gacttgtgcaaaaatggtgatatagattattgtgaactcaatgccaggtttggattcagg
aacatcatcgcggatcctgtcaccttcaagaccaaatcaagctatgttgccttagctaca
ttgcaagcctacacttctatgcatctatttttccaattcaagacaacatccctagatgga
ctaattctgtataacagtggggatggaaatgactttattgtggttgaattagttaaaggg
tacttacattatgtgtttgacttgggaaatggtgctaacctcatcaaagggagctcaaac
aaaccactcaacgacaatcagtggcacaatgtgatgatttcaagggacaccagcaatctc
cacacagtaaagatcgacacaaaaatcacaacacaaatcactgcgggagccagaaactta
gacctcaagagtgacttgtatattggaggagtggctaaagaaacatacaaatcgttgccg
aaactggtccatgctaaagaaggctttcaaggttgcctggcatctgtggacttgaatggc
aggcttccagacctcatatctgatgctcttttctgcaatgggcaaattgagagaggatgc
gaagggcccagcacaacctgtcaagaggactcatgttcaaatcaaggcgtgtgcttgcag
caatgggatggctttagctgtgactgtagcatgacttccttcagtggcccgctctgcaat
gaccctgggacgacgtatatctttagcaaaggtggtggacaaattacacataagtggcct
cctaatgaccgacccagtacacgagcagacaggctggccatcgggtttagcactgttcag
aaggaagcagtgttggtgcgtgtggacagttcctcaggcctgggtgactaccttgagctg
cacatacaccaaggaaaaattggagttaaatttaatgttgggacagatgacatcgccatt
gaggagtccaatgcaatcattaatgatggaaaataccatgtagtgcgtttcacgaggagt
ggtggcaatgccacgttacaggtggacagctggccagtcatcgaacgataccctgcagga
aacaatgataacgagcgcctggcgattgctagacagcgaattccatatcgacttggtcga
gtagttgatgaatggctactcgacaaagggcgtcagctcacaatcttcaatagccaagca
accataataattggcgggaaagagcagggccagcccttccagggccagctctctgggctt
tactacaatggcttgaaagttctgaatatggcggcagaaaacgatgccaacatcgccata
gtgggaaatgtgaggctggtcggtgaagtgccttcctctatgacaactgagtcgacagcc
actgccatgcagtccgagatgtccacctcaatcatggagaccaccacaaccctggctacc
agcacagctcgacgaggaaagccccccacaaaggagcctatcagccagaccacggatgat
atccttgtggcctcggcagagtgtcccagcgacgatgaggacattgacccctgtgagccg
agctcaggtgggttagccaaccccacccgagtgggcggccgcgaaccatacccaggctcg
gcagaggtgatccgggagtctagcagtaccactggcatggtggtggggattgtcgcagca
gcagctctgtgcatcctcatcctcctctatgccatgtacaagtacagaaaccgggatgaa
ggctcatatcacgtggatgagagtcgaaactacatcagtaactcagcacagtccaatggg
gctgtggtcaaggagaagcagcccagcagtgcgaaaagcgccaacaaaaacaagaagaac
aaggataaggagtattatgtctga

DBGET integrated database retrieval system