KEGG   Rattus norvegicus (rat): 60395Help
Entry
60395             CDS       T01003                                 

Gene name
Trpc3, TrpC3c, Trrp3
Definition
(RefSeq) transient receptor potential cation channel, subfamily C, member 3
  KO
K04966  transient receptor potential cation channel subfamily C member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    60395 (Trpc3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:rno04040]
    60395 (Trpc3)
Ion channels [BR:rno04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   60395 (Trpc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans TRP_2 PKD_channel Ank_2 Ank_4 Ank PBC
Motif
Other DBs
NCBI-GeneID: 60395
NCBI-ProteinID: NP_068539
RGD: 61973
Ensembl: ENSRNOG00000016070
UniProt: F1LNQ7
Position
2q25
AA seq 838 aa AA seqDB search
MARPREPSRSAAAGAGGASTAGWSRPARARRRPRGPTQYGNIPVVRKMLEESRTLNVNCV
DYMGQNALQLAVGNEHLEVTELLLKKENLARIGDALLLAISKGYVRIVEAILGHPGFAAS
RRLTLSPCEQELRDDDFYAYDEDGTRFSPDITPIILAAHCHKYEVVHLLLLKGARIERPH
DYFCRCADCAEKQRLDAFSHSRSRINAYKGLASPAYLSLSSEDPVLTALELSNELAKLAN
IEKEFKNDYRKLSMQCKDFVVGVLDLCRDSEEVEAILNGDLESVEPLERHGHKASLSRVK
LAIKYEVKKFVAHPNCQQQLLTIWYENLSGLREQTIAIKCLVVLVVALGLPFLAIGYWIA
PCSRLGKILRSPFMKFVAHAASFIIFLGLLVFNASDRFEGITTLPNITVIDYPKQIFRVK
TTQFTWTEMLIMVWVLGMMWSECKELWLEGPREYIVQLWNVLDFGMLSIFIAAFTARFLA
FLQATKAQQYVDSHVQESDLSEVTLPPEVQYFTYARDKWLPSDPQIISEGLYAIAVVLSF
SRIAYILPANESFGPLQISLGRTVKDIFKFMVLFIMVFLAFMIGMFILYSYYLGAKVNPA
FTTVEESFKTLFWSIFGLSEVTSVVLKYDHKFIENIGYVLYGIYNVTMVVVLLNMLIAMI
NSSYQEIEDDSDVEWKFARSKLWLSYFDDGKTLPPPFSLVPSPKSFVYFIMRITNFSKCR
RRRLQKDLELGMGNSKSRLNLFTQSNSRVFESHSFNSILNQPTRYQQIMKRLIKRYVLKA
QVDKENDEVNEGELKEIKQDISSLRYELLEDKSQATEELAILIHKLSEKLNPSALRCE
NT seq 2517 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggccgagggagccgagccgcagcgccgccgccggggctggaggggcgtcaacg
gcgggctggagccgccctgcccgcgcgcgccgccgtccccggggcccgacgcagtacggc
aacatccctgtggtgcgcaagatgctggaggagtctcgcacgctcaatgtcaactgcgtg
gactacatgggccagaatgcgctgcagctggccgtgggcaatgagcatctggaggtgacc
gagctgctgctgaagaaggagaacctggcgcgtatcggtgatgcgctgctgctcgccatc
agcaaaggctatgtgcgcatcgtggaggccatcctaggccacccaggctttgcggccagc
cggcgcctgaccctcagcccttgcgagcaagaactgcgcgatgacgacttctatgcttac
gacgaggatggcacacgcttctcacctgacatcacgcccatcatcctggctgcgcattgc
cataaatacgaggtggtgcacctgctgctactcaagggtgcacgcatcgagcggccacac
gactacttctgtcgctgcgccgactgtgctgagaagcaaaggcttgatgccttcagccac
tcaaggtctaggatcaatgcctacaagggactggccagcccagcatacttgtcgctgtcc
agcgaggaccctgtgctcacagcgctggaactcagcaatgagctggccaagctggccaac
atagagaaggagttcaagaatgactacaggaagctctccatgcagtgcaaagacttcgta
gtaggtgtgctggacctgtgccgggactcagaggaggtggaagccattctgaatggagat
ctggaatcggtggaacccctggagagacacgggcacaaggcgtcgctgagtcgggtcaaa
cttgccattaaatatgaagtcaaaaagtttgtggctcaccccaactgccaacagcagctt
ttgaccatctggtacgagaacctctcgggccttcgggagcagaccatcgctatcaagtgt
ctggtcgtgttggtcgtggccttgggccttccattcctcgccatcggctactggattgca
ccttgtagcaggctggggaaaattcttcgaagccccttcatgaagttcgtggctcacgct
gcctccttcatcatcttcctgggtctgcttgtgttcaacgcctcagaccggtttgaaggc
atcaccacgctgcccaacatcaccgttattgactaccccaagcaaatcttcagggtgaag
accacccagttcacatggacagaaatgctaattatggtctgggttctcgggatgatgtgg
tctgagtgcaaggagctgtggctggaggggccccgggagtacatcgtgcagctgtggaac
gtgcttgacttcgggatgctctccatcttcattgctgccttcaccgccaggttcctagcg
tttctgcaagccaccaaagcgcagcagtatgtggacagccacgtgcaggagagcgacctg
agcgaagtcacactcccaccagaggttcagtatttcacctatgctagagataaatggctt
ccttctgaccctcagatcatatcggaaggcctctatgccatagctgtggtgctcagcttc
tcccggatcgcgtacattctccctgcaaacgagagctttgggcccttgcagatctctctg
gggaggactgtgaaggacatattcaagttcatggttctcttcatcatggtgttcctggct
ttcatgattggcatgttcatactttactcctactaccttggggccaaagtaaaccctgct
tttaccacggttgaagaaagtttcaagactttgttttggtccatatttggactctctgaa
gtgacttctgttgtcctcaaatatgaccacaaattcatagagaacattggctatgtcctt
tatggaatatacaatgtaactatggtggtcgttctgctcaacatgctgattgctatgatt
aacagctcataccaagaaatcgaggatgacagtgatgtagagtggaagtttgctcgttcc
aaactctggctatcctacttcgatgatggaaaaacattacctccacccttcagtctggtc
cctagtccaaaatcgtttgtttatttcatcatgaggatcactaacttttccaaatgcagg
aggagaagacttcagaaggatctggaactgggcatgggtaactcaaagtccaggttaaac
ctcttcactcagtctaactcgagagtttttgaatcacacagttttaacagcattctcaat
cagccaacacgatatcagcagataatgaaaagactcataaaacggtatgttttgaaagca
caagtagacaaagaaaatgatgaggtgaacgaaggtgaactgaaagaaatcaagcaggat
atctccagccttcgttacgaacttttggaagataagagccaagcgacggaggaactggcc
atcttgattcataaactcagtgagaaactgaaccccagtgcgctgaggtgtgaatga

DBGET integrated database retrieval system