KEGG   Rattus norvegicus (rat): 60396
Entry
60396             CDS       T01003                                 

Gene name
Cdkl3, Nkiatre, Nkiatreb
Definition
(RefSeq) cyclin-dependent kinase-like 3
  KO
K08824  cyclin-dependent kinase-like [EC:2.7.11.22]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rno01001]
    60396 (Cdkl3)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     60396 (Cdkl3)
Protein kinases [BR:rno01001]
 Serine/threonine kinases: CMGC group
  CDKL family
   60396 (Cdkl3)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like RIO1 Kdo FTA2 MdcG APH Pkinase_fungal YrbL-PhoP_reg
Other DBs
NCBI-GeneID: 60396
NCBI-ProteinID: NP_068540
RGD: 619874
Ensembl: ENSRNOG00000059485
UniProt: Q9JM01
Position
10q22
AA seq 457 aa
MEMYETLGKVGEGSYGTVMKCKHKDTGRIVAIKIFYEKPEKSVNKIATREIKFLKQFRHE
NLVNLIEVFRQKKKIHLVFEFIDHTVLDELQHYCHGLESKRLRKYLFQILRAIEYLHNNN
IIHRDIKPENILVSQSGITKLCDFGFARTLAAPGDVYTDYVATRWYRAPELVLKDTTYGK
PVDIWALGCMIIEMATGNPYLPSSSDLDLLHKIVLKVGNLTPHLHNIFSKSPIFAGVVLP
QVQHPKNARKKYPKLNGLLADIVHACLQIDPAERISSTDLLHHDYFTRDGFIEKFIPELR
AKLLQEAKVNSFIKPKENFKENEPVRDEKKPVFTNPLLYGNPTLYGKEVDRDKRAKELKV
RVIKAKGGKGDVPDLKKTESEGEHRQQGTAEDTHPTSLDRKPSVSELTNPVHPSANSDTV
KEDPHSGGCMIMPPINLTSSNLLAANPSSNLSHPNSR
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggagatgtatgaaacccttggaaaagtaggagagggaagttatggaacggtcatgaaa
tgcaagcataaggatactgggcggatagtggccattaagatattctatgagaaaccagaa
aaatctgtcaacaaaattgcaacgagagaaataaagtttctaaagcaatttcgtcatgaa
aacctggtcaatctgattgaagtttttagacaaaaaaagaaaatccatttggtatttgag
tttattgaccacacggtcttagatgagttacagcattattgtcacggattagagagtaag
cgactaagaaagtacctgttccagatcctccgagcgatcgagtatctgcacaacaacaac
attatccaccgagatataaagcctgagaatattttagtctcccagtcaggaattacaaag
ctctgcgattttgggtttgcgcggacactagcagctcctggagacgtttacacagactac
gtggccacccgctggtacagagctccagagctggtgttgaaagacaccacctatggaaaa
ccagtggatatctgggctttgggctgtatgatcattgaaatggccactggcaatccctac
cttcctagcagttccgatttggatttgctccacaagattgttttaaaagtaggcaacctg
accccgcacctgcacaatattttttccaagagtcccatctttgctggggtggttcttcct
caagttcaacatcccaaaaacgcaagaaagaaatacccaaagctcaacggattgctggca
gatatagttcatgcttgtttacaaattgatcctgctgagaggatatcatccaccgatctt
ttgcatcacgattactttactagagatggatttattgagaaatttataccagagctgaga
gctaagttattacaggaagcaaaggttaattcatttataaagccaaaagagaattttaag
gaaaatgaacctgtgagagatgagaaaaaaccagtttttaccaaccctctgctctatgga
aacccaacactttatggaaaggaagtggacagagacaaaagggccaaggagctcaaagtc
agagtcattaaggccaaagggggaaaaggagacgtcccagacctgaagaagacagagagt
gaaggtgaacaccgccagcagggcacagctgaggacacacaccccacatcactggacagg
aagccttctgtctcggaactaacaaaccctgtccatcccagtgcgaattctgacactgtc
aaagaagacccacactctgggggctgtatgataatgccacctatcaacctgacaagcagt
aatttgttggccgcaaatcccagttcaaacctctcccaccccaattcacggtga

DBGET integrated database retrieval system