KEGG   Rattus norvegicus (rat): 60417Help
Entry
60417             CDS       T01003                                 

Gene name
Ecel1, Dine
Definition
(RefSeq) endothelin converting enzyme-like 1
  KO
K09610  endothelin-converting enzyme-like 1 [EC:3.4.24.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    60417 (Ecel1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-  
     60417 (Ecel1)
Peptidases and inhibitors [BR:rno01002]
 Metallo peptidases
  Family M13: neprilysin family
   60417 (Ecel1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M13_N Peptidase_M13
Motif
Other DBs
NCBI-GeneID: 60417
NCBI-ProteinID: NP_068544
RGD: 61806
Ensembl: ENSRNOG00000019447
UniProt: Q9JHL3
Position
9q35
AA seq 775 aa AA seqDB search
MEAPYSMTAHYDEFQEVKYESRCGTGGARGTSLPPGFPRSSGRSASGARSGLPRWNRREV
CLLSGLVFAAGLCAILAAMLALKYLGPGAAGTGGACPEGCPERKAFARAARFLSANLDAS
IDPCQDFYSFACGGWLRRHAIPDDKLTYGTIAAIGEQNEERLRRLLARPTGGPGGAAQRK
VRAFFRSCLDMREIERLGPRPMLEVIEDCGGWDLGGAADRPGAARWDLNRLLYKAQGVYS
AAALFSLTVSLDDRNSSRYVIRIDQDGLTLPERTLYLAQDEGSEKVLAAYKVFMERLLRL
LGADAVEQKAQEILQLEQRLANISVSEYDDLRRDVSSVYNKVTLGQLQKITPHLQWKWLL
DQIFQEDFSEEEEVVLLATDYMQQVSQLIRSTPRRILHNYLVWRVVVVLSEHLSPPFREA
LHELAKEMEGNDKPQELARVCLGQANRHFGMALGALFVHEHFSAASKAKVQQLVEDIKYI
LGQRLEELDWMDAQTKAAARAKLQYMMVMVGYPDFLLKPEAVDKEYEFEVHEKTYLKNIL
NSIRFSIQLSVKKIRQEVDKSTWLLPPQALNAYYLPNKNQMVFPAGILQPTLYDPDFPQS
LNYGGIGTIIGHELTHGYDDWGGQYDRSGNLLHWWTEASYSRFLHKAECIVRLYDNFTVY
NQRVNGKHTLGENIADMGGLKLAYYAYQKWVREHGPEHPLHRLKYTHNQLFFIAFAQNWC
IKRRSQSIYLQVLTDKHAPEHYRVLGSVSQFEEFGRAFHCPKDSPMNPVHKCSVW
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atggaggccccgtattccatgacagcgcactatgatgagttccaggaagtcaagtacgag
agccggtgtggcaccgggggcgcccgagggacctccctacctccaggcttcccgaggagc
tcagggcgcagtgctagcggggcccggtcggggctaccgcgctggaaccgacgggaggtg
tgcctgttgtccgggctggtgttcgccgccggcctctgtgccatcttggcagccatgctg
gcgctcaaatacctgggccctggcgcggcgggcactggcggagcctgtcccgagggctgc
cccgagcgcaaggccttcgcgcgcgccgcccgcttcctgtctgccaacctggacgccagc
atcgacccgtgccaggacttctactcgttcgcgtgcgggggctggctgcggcgccacgcc
atccccgacgacaagctcacctatggcacgatcgcggccatcggagagcagaacgaggag
cgcctgcggcgcctgctggcgagacccacgggaggcccgggcggcgctgcgcagcgcaag
gtgcgcgccttcttccgctcgtgtctcgacatgcgtgagatcgagaggctcgggccgcgg
cccatgctggaggtcatcgaggactgcggcggctgggacctaggcggcgcggccgatcgc
ccgggggcggctcgctgggacctcaaccgactgttgtacaaggcacagggtgtgtacagc
gcggccgcgctcttctcgcttacagtcagcctggacgacaggaactcctcgcgctacgtc
atccgtattgaccaggacgggctcaccctgccagagagaaccctgtacctagctcaagat
gaggggagtgagaaggtcctggccgcatacaaggtgttcatggagcgcctactcagacta
ctgggtgcagacgctgtggaacagaaggctcaggaaatccttcaactggagcagaggcta
gctaatatctctgtgtcagaatatgatgatctccgtcgagatgtcagctccgtgtacaac
aaagtgactctggggcagctgcagaagatcaccccccatttgcagtggaaatggctgctg
gaccagatcttccaggaggacttctctgaagaggaggaggtggtgctgctggccacagac
tacatgcagcaggtgtcccagctcatccgatccacaccccgaaggatccttcacaactac
ctagtgtggcgtgtggtggtggttctgagtgagcacctgtccccaccattccgagaggca
ctgcatgagctggccaaagagatggagggcaatgacaaaccccaggagttggcccgagtc
tgcctgggccaggccaaccgccacttcggcatggctcttggtgccctctttgtacacgaa
cacttctcagctgccagtaaagccaaggtacagcagctggtggaagatatcaagtacatc
ttaggccagcgcctggaggagctggactggatggacgcccagaccaaggcagctgctcgg
gctaagctccagtacatgatggtcatggttggctatccagacttcctgctgaaacctgag
gctgtagacaaagagtatgagtttgaggtccacgagaagacctacctcaagaacattttg
aacagcatccgattcagcatccagttgtctgtcaagaagatccgacaggaggtggacaaa
tccacgtggctgctccctccgcaggcgctcaatgcctactatctgcccaacaagaaccaa
atggtattcccagctggcatcttgcagcccaccctgtatgacccagacttcccgcagtct
ttgaactacgggggcatcggtaccatcattgggcatgaactgacccacggctatgatgac
tggggaggacagtatgaccgctcaggaaacctgctgcactggtggactgaggcctcctac
agccgctttctgcacaaggccgagtgcattgttcgcctctatgacaacttcaccgtctac
aaccagcgggtgaatgggaaacacacacttggcgagaacatcgcagacatgggaggcctc
aagctggcctactatgcctatcagaagtgggtccgggagcatggcccagaacacccgctg
caccggctcaagtacacccacaaccagcttttcttcattgcctttgcccagaactggtgc
atcaagcgacggtcacagtccatctacctgcaggtgctgacagacaaacacgcacctgag
cactaccgggtcctgggtagcgtgtcccagtttgaggaattcggccgggccttccactgt
cccaaggactctcccatgaaccctgtccataaatgctctgtgtggtga

DBGET integrated database retrieval system