KEGG   Rattus norvegicus (rat): 60422Help
Entry
60422             CDS       T01003                                 

Gene name
Slc18a3, VACht, rVAT
Definition
(RefSeq) solute carrier family 18 member A3
  KO
K14636  MFS transporter, DHA1 family, solute carrier family 18 (vesicular acetylcholine transporter), member 3
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04721  Synaptic vesicle cycle
rno04725  Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    60422 (Slc18a3)
   04721 Synaptic vesicle cycle
    60422 (Slc18a3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    60422 (Slc18a3)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC18: Vesicular amine transporter
   60422 (Slc18a3)
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    60422 (Slc18a3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_4
Motif
Other DBs
NCBI-GeneID: 60422
NCBI-ProteinID: NP_113851
RGD: 62072
Ensembl: ENSRNOG00000062141
Vega: OTTRNOG00000002353
UniProt: Q62666
Position
16p16
AA seq 530 aa AA seqDB search
MEPTAPTGQARAAATKLSEAVGAALQEPQRQRRLVLVIVCVALLLDNMLYMVIVPIVPDY
IAHMRGGSEGPTLVSEVWEPTLPPPTLANASAYLANTSASPTAAGSARSILRPRYPTESE
DVKIGVLFASKAILQLLVNPLSGPFIDRMSYDVPLLIGLGVMFASTVMFAFAEDYATLFA
ARSLQGLGSAFADTSGIAMIADKYPEEPERSRALGVALAFISFGSLVAPPFGGILYEFAG
KRVPFLVLAAVSLFDALLLLAVAKPFSAAARARANLPVGTPIHRLMLDPYIAVVAGALTT
CNIPLAFLEPTIATWMKHTMAASEWEMGMVWLPAFVPHVLGVYLTVRLAARYPHLQWLYG
ALGLAVIGVSSCVVPACRSFAPLVVSLCGLCFGIALVDTALLPTLAFLVDVRHVSVYGSV
YAIADISYSVAYALGPIVAGHIVHSLGFEQLSLGMGLANLLYAPVLLLLRNVGLLTRSRS
ERDVLLDEPPQGLYDAVRLREVQGKDGGEPCSPPGPFDGCEDDYNYYSRS
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaccgcgccaaccggtcaggcccgggcggcggccaccaaactgtcggaagcg
gtgggagccgcgctacaagagccccagaggcagcggcgcctggtgctggtcatcgtgtgc
gttgcactgttactggacaacatgttgtacatggtcatcgtgcccattgttcccgactat
atcgcccacatgcgcgggggcagcgagggcccgaccctggtctctgaggtgtgggaaccc
actctgccgccgcccactctggctaatgccagtgcctacttggccaacacgtcggcgtcc
ccgacggctgccgggtcggctcggtcaatcctgcgacctcgctaccccacagaaagcgaa
gatgtgaagataggtgtgctgtttgcctccaaggctatcctgcagcttctggtgaacccc
ttaagcgggcctttcattgatcgcatgagctacgacgtgccgctgcttataggcctgggc
gtcatgttcgcctccacagtcatgtttgcctttgcagaagactatgccacgctcttcgct
gcgcgcagtctacaaggcctgggctcggccttcgcggacacgtctggcattgccatgatc
gccgacaagtatcccgaggagcctgagcgcagtcgtgccctgggcgtggcgctagccttt
attagctttggaagcctagtggcgccaccgtttgggggcatcctctacgagttcgcgggc
aagcgtgtaccctttctagtgctcgccgctgtgtcccttttcgacgcgctcctgctcctg
gcggtggctaagcccttctcggctgcggctcgggcgcgagccaacctgccggtgggcaca
cctatccatcgcctcatgctagacccttacatcgctgtggtagccggcgcgctcaccact
tgtaacattccccttgcgttcctcgagcccaccatagccacgtggatgaagcacacaatg
gccgcatccgagtgggagatgggcatggtttggctgccggctttcgtgccacacgtgtta
ggcgtctacctcaccgtgcgcctggcggcgcgttatccacacctgcagtggctgtacggc
gctctcgggctagcggtaattggagtgagctcttgcgtcgtacctgcctgtcgctcattc
gcgccgttagtggtctcgctctgcggactctgcttcggcatcgcgttagtggacacagcg
ctcctacccacgctcgcctttctggtggacgtgcgccacgtatccgtctatggcagtgtc
tatgccatagctgacatctcctattctgtggcctacgcgctcgggcccatagtggcaggc
cacatcgttcactctcttggctttgagcagctcagcctgggcatgggcctggccaacctg
ctctacgcaccagtccttcttcttttgcgcaatgtaggcctccttacacgctcgcgttcg
gagcgcgatgtgttgcttgatgaaccgccgcagggtctgtacgacgcggtgcgcctgcgt
gaggtgcagggcaaggatggcggcgaaccttgtagcccacctggcccttttgacgggtgc
gaggacgactacaactattactcccgcagctag

DBGET integrated database retrieval system