KEGG   Rattus norvegicus (rat): 60423Help
Entry
60423             CDS       T01003                                 

Gene name
Slc28a2
Definition
(RefSeq) solute carrier family 28 member 2
  KO
K11536  pyrimidine nucleoside transport protein
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    60423 (Slc28a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC28: Na+-coupled nucleoside transporter
   60423 (Slc28a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate
Motif
Other DBs
NCBI-GeneID: 60423
NCBI-ProteinID: NP_113852
RGD: 61840
Ensembl: ENSRNOG00000028668
UniProt: Q62773
Position
3q35
AA seq 659 aa AA seqDB search
MAKSEGRKSASQDTSENGMENPGLELMEVGNLEQGKTLEEVTQGHSLKDGLGHSSLWRRI
LQPFTKARSFYQRHAGLFKKILLGLLCLAYAAYLLAACILNFRRALALFVITCLVIFILA
CHFLKKFFAKKSIRCLKPLKNTRLRLWLKRVFMGAAVVGLILWLALDTAQRPEQLISFAG
ICMFILILFACSKHHSAVSWRTVFWGLGLQFVFGILVIRTEPGFNAFQWLGDQIQIFLAY
TVEGSSFVFGDTLVQSVFAFQSLPIIIFFGCVMSILYYLGLVQWVIQKIAWFLQITMGTT
AAETLAVAGNIFVGMTEAPLLIRPYLADMTLSEIHAVMTGGFATIAGTVLGAFISFGIDA
SSLISASVMAAPCALALSKLVYPEVEESKFKSKEGVKLPRGEERNILEAASNGATDAIAL
VANVAANLIAFLAVLAFINSTLSWLGEMVDIHGLTFQVICSYVLRPMVFMMGVQWADCPL
VAEIVGVKFFINEFVAYQQLSQYKNKRLSGVEEWINGEKQWISVKAEIIATFSLCGFANL
TSIGITLGGLTSMVPQRKSDLCKLVVRALFTGACVSFISACMAGILYVPRGAETDCVSFL
NTNFTNRTYETYVCCRELFQSTLLNGTNMPSFSGPWQDKESSLRNLAKCCDLYTSTVCA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagtcagagggaagaaagtctgcttcccaggacacatcggagaatggcatggag
aacccaggcctggagctcatggaagtcggaaaccttgagcaaggcaaaacactggaggaa
gtgacacagggacatagcctgaaggatggcttggggcattcctctctctggaggaggatt
cttcagcccttcaccaaggcgagaagtttctatcaaagacatgctggtttattcaaaaag
atcctgcttggtctcttgtgtttagcgtatgctgcctacctcctggcagcttgcatcctg
aacttccggagggcactggccttgtttgtcatcacctgccttgtcatcttcatcctggct
tgccactttctgaaaaaattctttgctaaaaagtcaataagatgcttgaagcccttgaaa
aacacccgcctgagactttggcttaagagggtgttcatgggagccgctgttgtcggcctt
attctctggctggctctggacacagctcaaaggccagagcagctgatctcctttgcggga
atctgcatgttcatcctcatcctctttgcctgctccaaacaccacagtgcggtgagctgg
aggacagtgttttggggcctgggccttcagttcgtctttgggattttggtcatcagaact
gaacctggatttaatgcatttcaatggctgggagatcagatccagattttcctggcatat
actgtagaaggatccagttttgtttttggtgacacactggtccaaagtgtttttgctttt
cagtctctcccaatcattattttcttcggatgtgtgatgtctattctctactacctgggc
cttgtgcagtgggtgatccagaagattgcctggttcctgcaaatcaccatgggtaccaca
gctgcagagaccctggccgtggcaggaaacatctttgtgggaatgacagaggcacctctg
ctcatccgtccctaccttgcagacatgaccctctctgaaatccatgcagtgatgactgga
ggctttgctactatagcaggcacagtgttgggagccttcatatcctttgggattgatgca
tcatccttgatttctgcctcagtgatggctgccccttgtgcacttgccttgtccaaactg
gtatatccagaagtagaagagtccaagttcaagagcaaggagggagtgaagctgcctcga
ggggaagagaggaatattctggaagccgcgagcaacggagccacagatgccatagcgctt
gttgctaatgttgcagccaacctgattgcctttctggctgtattggccttcatcaattct
accctttcctggctgggggaaatggtggatatccatggactcactttccaggtcatctgc
tcctatgtcctaaggccaatggttttcatgatgggtgtacagtgggcagactgcccattg
gtggctgagatagtgggagtcaaattcttcataaatgaatttgtggcctatcaacaactg
tctcagtacaagaacaaacgtctctctggagtcgaagagtggatcaatggcgagaaacag
tggatttctgtgaaggctgaaatcattgcaacattttctctctgtggatttgccaatctt
acttccatagggatcacactgggaggcttgacatccatggttccccaacggaagagtgac
ttgtgcaagcttgtggtcagggccctcttcacaggtgcctgtgtttccttcatcagtgcc
tgtatggcaggaatcctctatgttcccagaggcgctgaaactgactgtgtctcattctta
aacacaaatttcaccaacagaacctatgagacatatgtgtgctgcagagagctcttccag
agtactttgctgaatggcaccaacatgccttctttctcaggcccctggcaagacaaggag
tccagcctcaggaatcttgctaaatgctgtgacctctataccagcactgtgtgtgcctga

DBGET integrated database retrieval system