KEGG   Rattus norvegicus (rat): 60431
Entry
60431             CDS       T01003                                 

Gene name
Vapb
Definition
(RefSeq) vesicle-associated membrane protein-associated protein B
  KO
K10707  vesicle-associated membrane protein-associated protein B
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04979  Cholesterol metabolism
rno05014  Amyotrophic lateral sclerosis
rno05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    60431 (Vapb)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    60431 (Vapb)
   05022 Pathways of neurodegeneration - multiple diseases
    60431 (Vapb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60431 (Vapb)
Membrane trafficking [BR:rno04131]
 Autophagy
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    60431 (Vapb)
SSDB
Motif
Pfam: Motile_Sperm ZapB DUF6381
Other DBs
NCBI-GeneID: 60431
NCBI-ProteinID: NP_068619
RGD: 68326
Ensembl: ENSRNOG00000005331
UniProt: Q9Z269
Position
3
AA seq 243 aa
MAKVEQVLSLEPQHELKFRGPFTDVVTTNLKLGNPTDRNVCFKVKTTAPRRYCVRPNSGV
IDAGASLNVSVMLQPFDYDPNEKSKHKFMVQSMFAPPDTSDMEAVWKEAKPEDLMDSKLR
CVFELPAENAKPHDVEINKIMPTSASKTEAPVAAKPLTSPLDDAEVKKVMEECRRLQGEV
QRLREESRQLKEEDGLRARKALPSNSPMAALAASGKEEGLSARLLALVVLFFIVGVIIGK
IAL
NT seq 732 nt   +upstreamnt  +downstreamnt
atggcgaaggtggagcaggtcctgagtctcgagccacagcacgagctcaagttccgaggt
cccttcactgatgttgtcactaccaacctaaagctgggcaacccgacagaccggaacgtg
tgtttcaaagtgaagaccacagcgccgcgcaggtactgcgtgcggcccaacagtggggtc
attgatgccggggcctctctcaatgtgtctgtgatgttacagcctttcgattatgacccc
aatgagaaaagtaaacacaagtttatggttcagtctatgtttgctccgcccgacacttcc
gatatggaggcagtatggaaggaggcaaaaccggaagaccttatggattcaaaacttaga
tgtgtgtttgaattgccagcagaaaacgctaaaccacatgatgtagaaataaataaaatt
atgcctacaagtgcatccaagacagaagcaccggtggccgccaagcccctcacatcgccc
cttgatgacgcggaagtaaagaaggtgatggaagagtgcaggcggctgcagggggaggtg
cagaggcttcgggaggagagcaggcagctcaaggaagaagacgggcttcgggcgaggaag
gcactgccgagcaacagccccatggcggctctggctgccagcgggaaggaggagggcctc
agcgcgcggctgctggctctggtggtgctgttctttattgttggggtcattatagggaag
atcgccttgtag

DBGET integrated database retrieval system