KEGG   Rattus norvegicus (rat): 60434
Entry
60434             CDS       T01003                                 

Gene name
Bcl2l2, BCL-W, BCL-WEL, BCL-WS, Bclw
Definition
(RefSeq) Bcl2-like 2
  KO
K02163  apoptosis regulator BCL-W
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    60434 (Bcl2l2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    60434 (Bcl2l2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    60434 (Bcl2l2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     60434 (Bcl2l2)
Transporters [BR:rno02000]
 Other transporters
  Pores ion channels [TC:1]
   60434 (Bcl2l2)
SSDB
Motif
Pfam: Bcl-2 BH4 ABATE HTH_AsnC-type Apolipoprotein
Other DBs
NCBI-GeneID: 60434
NCBI-ProteinID: NP_068622
RGD: 620717
Ensembl: ENSRNOG00000015732
UniProt: O88996
Position
15p13
AA seq 193 aa
MATPASTPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRT
FSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVG
QVQDWMVTYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGAVAL
GALVTVGAFFASK
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcgaccccagcctcaaccccagacacacgggctctagtggctgactttgtaggctat
aagctgaggcagaagggttatgtctgtggagctggccctggggaaggcccagcagccgac
ccgctgcaccaagccatgcgggcagctggagacgagtttgagacccgcttccggcgcacc
ttctctgacctggccgctcagctacacgtgaccccaggctcagcccagcaacgcttcacc
caggtttccgacgaacttttccaagggggccccaactggggccgtcttgtggcattcttt
gtctttggggctgccctgtgtgctgagagtgtcaacaaagaaatggagccattggtggga
caagtgcaggattggatggtgacctacctggagacacgcttggctgactggatccacagc
agtgggggctgggcggagttcacagctctatacggggacggggccctggaggaggcacgg
cgtctgcgggaggggaactgggcatcagtgaggacagtgctgacgggggctgtggcactg
ggggccctggtaactgtaggggccttttttgctagcaagtga

DBGET integrated database retrieval system