KEGG   Rattus norvegicus (rat): 60445
Entry
60445             CDS       T01003                                 

Gene name
Tsc1
Definition
(RefSeq) hamartin
  KO
K07206  tuberous sclerosis 1
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04072  Phospholipase D signaling pathway
rno04140  Autophagy - animal
rno04150  mTOR signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04152  AMPK signaling pathway
rno04211  Longevity regulating pathway
rno04218  Cellular senescence
rno04714  Thermogenesis
rno04910  Insulin signaling pathway
rno05163  Human cytomegalovirus infection
rno05165  Human papillomavirus infection
rno05168  Herpes simplex virus 1 infection
rno05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    60445 (Tsc1)
   04151 PI3K-Akt signaling pathway
    60445 (Tsc1)
   04152 AMPK signaling pathway
    60445 (Tsc1)
   04150 mTOR signaling pathway
    60445 (Tsc1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    60445 (Tsc1)
  09143 Cell growth and death
   04218 Cellular senescence
    60445 (Tsc1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    60445 (Tsc1)
  09149 Aging
   04211 Longevity regulating pathway
    60445 (Tsc1)
  09159 Environmental adaptation
   04714 Thermogenesis
    60445 (Tsc1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    60445 (Tsc1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    60445 (Tsc1)
   05163 Human cytomegalovirus infection
    60445 (Tsc1)
   05165 Human papillomavirus infection
    60445 (Tsc1)
SSDB
Motif
Pfam: Hamartin ATG16
Other DBs
NCBI-GeneID: 60445
NCBI-ProteinID: NP_068626
RGD: 620124
Ensembl: ENSRNOG00000011470
UniProt: Q9Z136
Position
3
AA seq 1163 aa
MAQLANIGELLSMLDSSTLGVRDDVTTIFKESLNSERGPMLVNTLVDYYLETNSQPVLHI
LTTLQEPHDKHLLDKMNEYVGKAATRLSILSLLGHVVRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVVVLTTGVLVLITMLPMIPQSGKQHLLDFFDIFGRLSSWCLKKPGHVTEVYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENVETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKTLETHDVVIECAKISLDPTEASYEDGDAVSHQLSACFPHRSADVTTSSYVDT
QNSYGGATSTPSSTSRLMLFSTPGQLPQSLSSLSTRPLPEPLQASLWSPSAVCGMTTPPT
SPGNVPADLSHPYSKAFGTTTGGKGTPSGTPATSPPPAPPCPQDDCAHGPASQASATPPR
KEERADSSRPYLPRQQDVPSDRGLEDLPGSKGSVTLRNLPDFLGDLASEEDSIEKDKEEA
AISKELSEITTAEADPVAPRGGFDSPFYRDSLSGSQRKTHSAASGTQGFSVNPEPLHSSL
DKHGPDTPKQAFTPIDPPSGSADASPAGDRDRQTSLETSILTPSPCKIPPQRGVSFGSGQ
LPPYDHLFEVALPKTACHFVSKKTEELLKKAKGNPEEDCVPSTSPMEVLDRLLEQGAGAH
SKELSRLSLPSKSVDWTHFGGSPPSDEIRTLRDQLLLLHNQLLYERFKRQQHALRNRRLL
RKVIRAAALEEHNAAMKDQLKLQEKDIQMWKVSLQKEQARYSQLQQQRDTMVTQLHSQIR
QLQHDREEFYNQSQELQTKLEDCRSMIAELRVELKKANSKVCHTELLLSQVSQKLSNSES
VQQQMEFLNRQLLVLGEVNELYLEQLQSKHPDTTKEVEMMKTAYRKELEKNRSHLLQQNQ
RLDASQRRVLELESLLAKKDHLLLEQKKYLEDVKSQASGQLLAAESRYEAQRKITRVLEL
EILDLYGRLEKDGRLQKLEEDRAEAAEAAEERLDCCTDGCSDSLLGHNEEAAGHNGETRT
SRPGGTRASCGGRVTGGSSSSSSELSTPEKPPNQRFSSRWEPTMGEPSSSIPTTVGSLPS
SKSFLGMKTRELFRNKSESQCDEDGMTMSSFSETLKTELGKDSAGMENKTPPSLDAPHPS
SPSSDSMGQLHIMDYNETHHEHS
NT seq 3492 nt   +upstreamnt  +downstreamnt
atggcccagctagccaacattggggagctactctccatgctggactcttccacactgggt
gtgcgtgatgacgtgacaaccatcttcaaggagtccctcaattctgaacgtgggcctatg
cttgtaaacacgttggtggattattacctggaaaccaattctcagccggtcttgcacatc
ctgaccaccctgcaagagccacatgataagcacctcttggacaaaatgaatgagtatgta
ggcaaagctgccacccgcttatccatcctctcgctgctggggcatgttgtgaggctgcag
ccatcttggaagcataagctctctcaagcacctcttctgccttctttactgaaatgtctc
aagatggacactgatgttgtggttctcacaactggtgtcttggtgttgatcaccatgcta
ccgatgatcccgcagtcagggaagcagcaccttctcgacttctttgacatctttggccgt
ctttcatcatggtgcctgaagaaaccaggccatgtgacagaagtctacctggtccacctc
catgccagtgtttatgccctcttccatcgcctttatggaatgtacccttgtaacttcgtc
tccttcctgcgctctcactacagcatgaaggaaaacgtggagacttttgaagaagtggtc
aagccaatgatggagcatgtgcgaattcacccggaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagacattagaaactcatgatgttgtaatagagtgtgcc
aaaatctctctggaccctaccgaagcctcatatgaagatggcgatgctgtgtctcaccag
ctctctgcctgcttccctcaccgttcagctgatgtcaccaccagctcttacgtggacaca
cagaatagctatgggggcgctacttccaccccttcctccacctctcggctgatgttgttc
agtacccccgggcagctacctcagagtttgagttcactatcaacacggccgttacctgag
ccgctgcaagctagtctttggagcccatctgcagtctgtggtatgaccactcctcctacg
tctcctggaaatgtcccggctgatttgtcacatccatacagtaaagcctttggtactacc
actggtggaaaaggaactccttcaggaaccccagcgacctctcctcccccagccccgcct
tgtccccaagacgactgtgcgcacggtccagcctcccaggcctcagccacaccccccagg
aaggaagaaagagcagattcttcaaggccttacctacccagacagcaggatgttccgagt
gaccgcggattagaggatctacctggaagcaaaggttccgtcactctgaggaatctacca
gatttcctaggtgacctggcttcagaggaagacagtatagagaaagataaggaagaagct
gcgatatctaaagagctttctgagatcaccactgcagaggcggatcctgtagctcctcga
gggggctttgactctcccttctaccgagacagtctctctggttctcagcggaagactcac
tcagcagcctctgggactcagggcttcagcgtgaaccctgagcctttgcactcctccctg
gacaaacatgggcctgacacaccaaagcaagcctttactcccatagacccaccctctggc
agtgctgatgccagtcccgctggggacagggatcgccagacttctctggagaccagtatc
ctcactcccagcccttgcaaaattccacctcagaggggagtgagctttggaagtgggcag
cttcccccatatgatcatctctttgaggtggccttgccaaagactgcctgtcactttgtc
agcaaaaagactgaagagctgttgaagaaagcgaaaggaaaccctgaggaagactgtgtg
ccctctacctccccaatggaagtactggacagactgctagagcagggagcaggggcacac
agcaaggaactgagcaggttgtccttgcccagcaagtctgttgactggacccactttgga
ggctctcccccctcagatgagatccggaccctccgagaccagttgctcttactgcacaat
cagctgctgtacgaacgctttaagcggcagcagcatgcactgaggaacagaaggctgctg
cgcaaggtgatccgagctgcggccctggaggagcacaacgcagcgatgaaagatcagttg
aagttacaagagaaggacatccagatgtggaaggtgagtctgcagaaagaacaagcccga
tacagtcagcttcagcaacaacgtgacaccatggtgacccagctgcatagccaaatcaga
cagctgcagcatgaccgagaagaattctacaaccagagtcaggagttacagacgaagctg
gaggactgcagaagcatgatcgcggagcttcgagtggagctgaagaaggccaacagcaag
gtgtgccacaccgagctgctgctcagccaggtctctcagaagctctccaatagtgagtca
gtgcagcagcagatggagttcttgaataggcagctcctggtgctcggggaggtcaatgag
ctgtacctggagcagctgcagagcaagcatcctgacaccaccaaggaagtagaaatgatg
aaaactgcttatcggaaagaactagagaaaaacagaagccaccttctccagcagaaccag
aggctggatgcctcacagaggcgagttttagaactggaatctcttctggccaagaaagac
caccttctcctagagcagaagaagtaccttgaggatgtcaagagccaggcgagtggacag
ctgctggctgcagagagcaggtatgaggctcagagaaagatcacccgggtgttggaactg
gagatcctagacttgtatggtagattggagaaagatggccgcctacagaaactagaagag
gacagagcagaggcagcagaggcagctgaagagaggcttgactgttgtactgatggatgc
tcagattccttgttaggacataatgaagaggctgctggtcacaatggtgagaccaggacc
tccagacctggtggcacccgggccagctgtggaggtagagtcactggaggcagcagcagc
agcagcagtgagctttccactccagagaaacccccgaaccagaggttcagcagccggtgg
gagcccaccatgggtgagccctccagcagcatccccaccactgttggctcacttcccagt
tccaaaagcttcttgggcatgaagacccgggagctgttccgtaataagagtgagagccag
tgtgatgaggatggcatgaccatgagtagcttttctgagaccctgaagacagaactgggc
aaagactcggcgggcatggaaaacaagactcccccaagtctagacgccccacacccatct
tccccaagctcagacagtatggggcagctccatatcatggactacaatgagactcatcac
gaacacagctga

DBGET integrated database retrieval system