KEGG   Rattus norvegicus (rat): 60460Help
Entry
60460             CDS       T01003                                 

Gene name
Hspa2, Hspt70, Hst70
Definition
(RefSeq) heat shock protein family A member 2
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
rno  Rattus norvegicus (rat)
Pathway
rno03040  Spliceosome
rno04010  MAPK signaling pathway
rno04141  Protein processing in endoplasmic reticulum
rno04144  Endocytosis
rno04213  Longevity regulating pathway - multiple species
rno04612  Antigen processing and presentation
rno04915  Estrogen signaling pathway
rno05134  Legionellosis
rno05145  Toxoplasmosis
rno05162  Measles
Brite
KEGG Orthology (KO) [BR:rno00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    60460 (Hspa2)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    60460 (Hspa2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60460 (Hspa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60460 (Hspa2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    60460 (Hspa2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    60460 (Hspa2)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    60460 (Hspa2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    60460 (Hspa2)
  09172 Infectious disease: viral
   05162 Measles
    60460 (Hspa2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    60460 (Hspa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rno01009]
    60460 (Hspa2)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:rno03041]
    60460 (Hspa2)
   03009 Ribosome biogenesis [BR:rno03009]
    60460 (Hspa2)
   03110 Chaperones and folding catalysts [BR:rno03110]
    60460 (Hspa2)
   04131 Membrane trafficking [BR:rno04131]
    60460 (Hspa2)
   03051 Proteasome [BR:rno03051]
    60460 (Hspa2)
   03029 Mitochondrial biogenesis [BR:rno03029]
    60460 (Hspa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rno04147]
    60460 (Hspa2)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     60460 (Hspa2)
Spliceosome [BR:rno03041]
 Complex B
  Other components
   Prp19 complex
    60460 (Hspa2)
 Complex C
   Prp19-CDC5 complex
    60460 (Hspa2)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    60460 (Hspa2)
Chaperones and folding catalysts [BR:rno03110]
 Heat shock proteins
  HSP70 / DNAK
   60460 (Hspa2)
Membrane trafficking [BR:rno04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    60460 (Hspa2)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    60460 (Hspa2)
Proteasome [BR:rno03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    60460 (Hspa2)
Mitochondrial biogenesis [BR:rno03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    60460 (Hspa2)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   60460 (Hspa2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C BcrAD_BadFG DUF1464 DDR CRIC_ras_sig Zincin_2
Motif
Other DBs
NCBI-GeneID: 60460
NCBI-ProteinID: NP_068635
RGD: 620664
Ensembl: ENSRNOG00000006472
UniProt: P14659
Position
6q24
AA seq 633 aa AA seqDB search
MSARGPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQV
AMNPTNTIFDAKRLIGRKFEDATVQSDMKHWPFRVVSEGGKPKVQVEYKGEMKTFFPEEI
SSMVLTKMKEIAEAYLGGKVQSAVITVPAYFNDSQRQATKDAGTITGLNVLRIINEPTAA
AIAYGLDKKGCAGGEKNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRM
VSHLAEEFKRKHKKDIGPNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSI
TRARFEELNADLFRGTLEPVEKALRDAKLDKGQIQEIVLVGGSTRIPKIQKLLQDFFNGK
ELNKSINPDEAVAYGAAVQAAILIGDKSENVQDLLLLDVTPLSLGIETAGGVMTPLIKRN
TTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVT
FDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEADGYKSEDEANRDRVA
AKNAVESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQK
ELERVCNPIISKLYQGGPGGGGSSGGPTIEEVD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcccgcggcccggctatcggcatcgacctgggcaccacttactcgtgcgtgggg
gtcttccaacatggcaaggtggagatcatcgccaacgaccagggtaaccggaccaccccc
agctacgtggccttcaccgacaccgagcgccttatcggcgacgccgccaagaaccaagtg
gccatgaaccccacaaacaccatcttcgacgccaagcggctgatcggacggaagttcgaa
gacgccacggtgcagtcggatatgaagcactggccgttcagagtggtgagcgaaggtggg
aagcccaaagtgcaggtggaatataaaggggagatgaagaccttcttccctgaggagatt
tcttccatggtcctcactaagatgaaggagatcgccgaagcctacctggggggcaaggtg
cagagcgcagtcatcactgttcctgcctatttcaacgactcgcagcgccaggccaccaag
gatgcgggcaccatcaccggtctcaatgtattgcgtatcatcaacgaacccacagcagcg
gccatcgcttatggcctggataagaagggctgcgcgggcggcgagaagaacgtgctcatc
tttgacctgggcgggggcaccttcgatgtgtccatcctcaccatcgaggatggcatcttc
gaggtcaagtccacggccggcgacacccacctgggtggcgaagacttcgacaaccgtatg
gtcagccacctggcggaggagttcaagcgcaaacacaagaaggacattgggcccaacaag
cgcgctgtgcgccggctgcgcaccgcctgcgagcgcgctaagcgcaccctgagctcgtcc
acgcaggccagcatcgagatcgactcgctgtacgagggcgtggatttctacacgtccatc
acccgcgcccgcttcgaggagctcaacgccgatctctttcgagggactctggagccggtg
gaaaaggcgctgcgcgatgccaagctagacaagggccagatccaggagatagtgctggtg
ggcggctctacccgcatccctaagatccagaagctcctgcaggatttcttcaacggcaag
gagctgaacaagagcatcaatcccgacgaggcggtggcctacggcgccgctgtgcaggcg
gctatcctcattggcgacaagtctgagaacgtgcaggatctgctgttactcgacgtgact
cccttgtcgcttggcattgaaacagctggcggtgtcatgaccccactcataaagagaaac
accaccatccctaccaagcagacgcagaccttcactacctactcagacaaccagagcagc
gtgctggtgcaagtgtacgagggcgaacgggccatgaccaaggacaataacctcttgggc
aagttcgacctaactgggatccctccagcaccccgcggcgtcccccagatcgaggtcacc
tttgacatcgatgccaacggcattcttaacgtcactgctgcagacaagagcaccggcaaa
gaaaataaaatcaccatcaccaacgacaagggtcgtctgagcaaagacgacattgaccgg
atggtgcaggaggcagacgggtacaaatcggaagatgaagctaatcgcgatcgcgtggca
gccaaaaacgcggttgagtcctatacctacaacatcaagcagacggtggaagacgagaaa
ctgaggggcaagattagcgagcaggacaaaaacaagattctcgacaagtgtcaggaggtg
atcaactggcttgaccgaaaccagatggcagagaaagatgagtacgaacacaagcagaaa
gagcttgagagagtgtgcaaccccatcatcagcaaactttaccaaggcggtccaggcggc
ggcggctcctctggaggacccaccattgaggaagtggactag

DBGET integrated database retrieval system