KEGG   Rattus norvegicus (rat): 60462Help
Entry
60462             CDS       T01003                                 

Gene name
Batf3, Jdp1
Definition
(RefSeq) basic leucine zipper ATF-like transcription factor 3
  KO
K09034  ATF-like basic leucine zipper transcriptional factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    60462 (Batf3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:rno03000]
    60462 (Batf3)
Transcription factors [BR:rno03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    60462 (Batf3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf HALZ ATG16 TPD52 HAUS-augmin3 Fez1 DUF3450 HAP1_N Atg14 DUF5320 Cnn_1N Baculo_gp64 DivIC DUF1515 FmiP_Thoc5 TMCO5 ADIP KxDL DUF4192 WDCP AAA_11 DUF16 APG6_N UPF0242 FapA ZapB PRP1_N TMF_DNA_bd DUF3584 RmuC JIP_LZII
Motif
Other DBs
NCBI-GeneID: 60462
NCBI-ProteinID: NP_068637
RGD: 620501
Ensembl: ENSRNOG00000003716
UniProt: P97876
Position
13q27
AA seq 133 aa AA seqDB search
MSQGPPAGGVLQSSVAAPGNQPQSPKDDDRKVRRREKNRVAAQRSRKKQTQKSDKLHEEH
ESLEQENSVLRREIAKLKEELRHLTEALKEHEKMCPLLLCPMNFVQLRPDPVASWSAHDA
PDHPSFIWLGTLV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaagggccccccgcgggcggcgtgctgcagagcagcgtggcggcgcctgggaac
cagccgcagagccccaaggatgatgacaggaaggttcgaagaagagagaaaaaccgggtt
gcagctcagaggagccgaaagaagcagacacagaagtctgacaagcttcacgaggaacat
gagagtctggagcaggagaactctgtgctgcgcagggagatcgcgaagctgaaggaggag
ctgcggcacctgactgaggcgctgaaggagcacgagaagatgtgcccgctgctgctctgc
ccgatgaactttgtgcagcttcggccagaccccgtggccagctggtctgcccatgatgcc
ccagatcacccctcttttatctggctcggaaccttggtttga

DBGET integrated database retrieval system