KEGG   Rattus norvegicus (rat): 60563Help
Entry
60563             CDS       T01003                                 

Gene name
Hr
Definition
(RefSeq) HR, lysine demethylase and nuclear receptor corepressor
  KO
K00478  lysine-specific demethylase hairless [EC:1.14.11.-]
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rno03036]
    60563 (Hr)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     60563 (Hr)
Chromosome and associated proteins [BR:rno03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    60563 (Hr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC
Motif
Other DBs
NCBI-GeneID: 60563
NCBI-ProteinID: NP_077340
RGD: 620634
Ensembl: ENSRNOG00000011427
UniProt: A0A0G2K5M5
Position
15p11
AA seq 1181 aa AA seqDB search
MESMPSFLKDTPAWEKTAPVNGIVGQEPGTSPQDGLHHGALCLGEPVPFWRGVLSAPDSW
LPPGFLQGPKDTLSVVEGEGSRNGERKANWLGSKEGLRWKEAMLAHPLAFCGPACPPRYG
PLIPEHSSGHPKSDPVAFRPLHCPFLLETKILERAPFWVPTCLPPYLMSSLPPERSYDWP
LAPSPWVYSGSQPKVPSAFSLGSKGFYHKDPNILRPAKEPLAASESGMLGLAPGGHLQQA
CDAEGPSLHQRDGETGAGRQQNLCPVFLGYPDTVPRTPWPSCPPGLVHTLGNVWAGPGSN
SFGYQLGPPVTPRCPSPGPPTPPGGCCSSHLPAREGDPGPCRKCQDSPEGSSSGPGESSE
ERNKAGSRASPPSHHTKLKKTWLTRHSEQFECPGGCPGKGESPATGLRALKRAGSPEVQG
ARGPAPKRPSHTFPGTGRQGARAWQETPETSTGSKAEAQQQEEQRGPRDGRIRLRESRLE
DTSCQHHLAGVTQCPSCVQAAGEVEILTSHSQKSHRLPLEEKPLEEDSCATSEEGGGSSP
EASINKGLAKHLLSGLGDRLCRLLRKEREALAWAQREGQGPAMTEDSPGIPHCCSRCHHG
LFNTHWRCSHCSHRLCVACGRIAGAGKNREKTGSREQRTDDCAQEAGHAACSLILTQFVS
SQALAELSTVMHQVWAKFDIRGHCFCQVDARVWAPGDGGQQKEPTEKTPPAPQLSCNGDS
NRTKDIKEETPDSTESPAEDRAGRSPLPCPSLCELLASTAVKLCLGHERIHMAFAPVTPA
LPSDDRITNILDSIIAQVVERKIQEKALGPGLRAGSGLRKGLSLPLSPVRTRLSPPGALL
WLQEPRPKHGFRLFQEHWRQGQPVLVSGIQKTLRLSLWGMEALGTLGGQVQTLTALGPPQ
PTSLDSTAFWKGFSHPEARPKLDEGSVLLLHRPLGDKDESRVENLASSLPLPEYCAHQGK
LNLASYLPLGLTLHPLEPQLWAAYGVNSHRGHLGTKNLCVEVSDLISILVHAEAQLPPWY
RAQKDFLSGLDGEGLWSPGSQTSTVWHVFRAQDAQRIRRFLQMVCPAGAGTLEPGAPGSC
YLDSGLRRRLREEWGVSCWTLLQAPGEAVLVPAGAPHQVQGLVSTISVTQHFLSPETSAL
SAQLCHQGASLPPDHRMLYAQMDRAVFQAVKVAVGTLQEAK
NT seq 3546 nt NT seq  +upstreamnt  +downstreamnt
atggagagtatgcccagcttcctgaaggacaccccagcctgggagaagactgcccctgtg
aacggcattgtgggacaggagcctggtacctccccgcaggatggcttgcaccatggggca
ctgtgcctaggagaacctgttcccttttggaggggtgttctgagcgccccagactcctgg
ctccctcctggcttcctccaaggccccaaggacacactctcagtggtggagggtgagggt
tctcggaatggggagaggaaagccaactggctgggtagcaaggagggactacgctggaag
gaagcgatgctggcccatccactggccttctgtgggccagcatgcccacctcgctatggc
cccctgatacctgagcatagcagtggccatcccaagagtgaccctgtggccttccggccc
ttgcactgccctttcctgctggagaccaagattctagagcgagctcccttctgggttcct
acctgcttgcctccctacctgatgtccagcctgcctccagagcgttcgtatgactggcct
ttggccccaagcccctgggtatactctgggagccagccaaaagtgccctctgccttcagc
ttaggcagcaagggcttttaccacaaggatccaaacatcctcaggccagcaaaggagccc
ttggcagcgtcagagtctgggatgttgggcttagctcctggagggcatctccagcaagcc
tgcgatgcagaaggcccctcgcttcaccagagggatggggagacaggagctggcaggcag
cagaatctttgcccagttttcttggggtacccagacactgttcctcgaaccccctggcct
tcttgtcccccaggcctggttcacactctcggtaacgtttgggctgggccaggaagtaac
agctttgggtaccagctaggcccaccagtcacaccaaggtgcccatcacctgggcctccc
acccctccagggggctgttgctcatcccatctgcctgccagagagggtgatcctggccct
tgtaggaaatgtcaggatagcccagagggaagtagcagtgggccaggggaatccagtgaa
gaaagaaacaaggctggctccagggcctctcctccaagccatcacaccaagctgaaaaag
acctggctcacacgccactcggaacagttcgagtgcccaggtggctgtcctgggaaggga
gagagcccagccactgggctccgggcactcaagagggcaggcagtccagaggtccaggga
gcaaggggcccggctcccaaacgcccatcccacactttcccaggtactgggaggcagggg
gccagggcttggcaggagacaccagagacatccacaggaagcaaggcagaggcacagcaa
caagaggagcaaagagggccccgagatggcaggattcggctccgggaatccagacttgag
gatacatcctgccagcatcacttagcaggtgtcactcagtgcccaagctgtgtccaggca
gctggagaggtggagatactgaccagccactcccagaaatcacataggttacccctggaa
gagaagccgttggaggaggattcctgtgccacttctgaggaaggaggagggtctagccca
gaagcttccatcaacaagggcctagccaagcatctactgagtggtctgggtgaccgactc
tgccgcctgctgcggaaggagcgggaagccctcgcctgggcacagcgtgaaggccagggg
ccagccatgacagaggacagcccaggcattccacactgctgcagccgttgccaccacgga
ctcttcaacacccactggagatgttcccactgtagccaccggctgtgtgtagcctgtggt
cgcatagccggagctgggaagaacagggagaaaacaggctctcgggagcagcgcacagat
gactgtgcccaggaggctgggcatgctgcctgttccctgattctgacccagtttgtctcc
agccaggcgctggcagaactgagcactgtgatgcaccaagtctgggccaagtttgacatt
cgggggcactgtttctgtcaagtcgatgcccgtgtgtgggcccccggggatgggggtcag
cagaaggaaccaacagagaaaactcccccagctccacaactttcctgcaatggagattcc
aatcggaccaaggacatcaaagaagagaccccagactccacagagagcccagcagaggac
cgtgctggccggtcaccacttccttgtccctctctttgtgagctgctagcctctacagct
gtcaaactctgcctggggcatgagcggattcacatggcctttgccccggtcaccccggct
ctgcccagtgatgaccgcattaccaacatcctggacagcattattgcgcaggtagtagaa
cggaagatccaagagaaagccctggggccaggccttcgagcagggtcaggcttacgaaag
ggcctcagcctgcccctgtcaccagtgcgaacccggttgtctcctcctggagctctgctg
tggctgcaagagcccaggcctaagcacggctttcgtctcttccaggagcactggcggcag
ggccagcctgtgttagtatcaggcatccagaagacattgagacttagcctgtggggaatg
gaagcccttgggacacttggtggccaggtgcagacactgactgcccttgggccgccccaa
cccaccagcctggacagcacagcattctggaagggattctctcatcctgaggcacgtcca
aagttagatgagggctctgtcctcctgctacaccgacccctgggggataaggacgagagc
agggtggagaaccttgcctccagccttccactcccagagtactgtgcccaccaagggaaa
ctcaacctagcgtcctacctccccctgggtctcacactgcatccactggagccccagctc
tgggcagcctatggtgtgaactcgcaccgtggacacctggggaccaagaacctatgtgtg
gaggtgtctgacctaatcagtatcctggtgcatgctgaggcacagctgcctccctggtac
cgagcacagaaagattttctctcaggcctggatggggaagggctctggtctccaggtagc
cagaccagcactgtgtggcatgtgttccgagcccaggatgcccagcgtatccgtcgcttt
ctccagatggtgtgcccagctggagcaggaaccttggagcctggtgccccaggcagctgc
tacttggattcagggttgcgacgcaggttaagggaggagtggggtgtgagctgctggaca
ctgctgcaggctcctggagaagcggtgctggtgcctgctggggcaccccatcaggtacag
ggcttggtgagcacaatcagtgtcactcagcactttctgtctcctgagacctcggccctc
tctgctcagctctgccaccagggagccagcctgccccctgaccatcgtatgctttatgcc
cagatggaccgggctgtgttccaagcagtgaaggtggcggtggggacattacaggaagct
aaatag

DBGET integrated database retrieval system