KEGG   Rattus norvegicus (rat): 60565Help
Entry
60565             CDS       T01003                                 

Gene name
Syt6
Definition
(RefSeq) synaptotagmin 6
  KO
K19906  synaptotagmin-6
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60565 (Syt6)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    60565 (Syt6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: C2 PI3K_C2
Motif
Other DBs
NCBI-GeneID: 60565
NCBI-ProteinID: NP_071527
RGD: 62012
Ensembl: ENSRNOG00000019163
UniProt: Q62746
Position
2q34
AA seq 511 aa AA seqDB search
MSGVWGAGGPRCQAALAVLASLCRARPPPLGLDVETCQSFELQPPEQSPSAADSGTSVSL
LAVVVIVCGVALVAVFFFLFWKLCWMPWRNKEASSPSSANPASEILQSPSSRGNMADKLK
DPSALGFLEAAVKISHTSPDIPAEVQMSVKEHIMRHTKLQRQTTEPASSTRHTSFKRHLP
RQMHVSSVDYGNELPPAAAEQPTSIGRIKPELYKQKSVDGDEAKSEAAKSCGKINFSLRY
DYESETLIVRILKAFDLPAKDFCGSSDPYVKIYLLPDRKCKLQTRVHRKTLNPTFDENFH
FPVPYEELADRKLHLSVFDFDRFSRHDMIGEVILDNLFEASDLSRETSIWKDIQYATSES
VDLGEIMFSLCYLPTAGRLTLTVIKCRNLKAMDITGYSDPYVKVSLLCDGRRLKKKKTTI
KKNTLNPVYNEAIIFDIPPENMDQVSLLISVMDYDRVGHNEIIGVCRVGISAEGLGRDHW
NEMLAYPRKPIAHWHCLAEVKKSFKEGTPRL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgagcggagtttggggggccggagggcctcggtgccaggcggcgctcgcggtcctggcc
tctctgtgccgggcccggccgccccctctcgggctggacgtggagacttgtcagagcttc
gagctgcagcccccggagcagagtccaagcgcggccgactcaggcacctctgtcagcctc
ctcgcagtggtagttattgtgtgtggtgtggccctggtggcagtttttttctttctcttt
tggaagctgtgctggatgccctggaggaacaaggaggcctccagcccttcttctgctaac
cctgcttcagagatcctccaaagccccagctccagaggcaacatggcggataagctgaag
gaccccagtgccctgggcttcctggaggcagctgtaaagatcagccatacttccccagat
atcccagccgaggtgcagatgtcggtcaaagagcacattatgcgccacaccaaactgcag
cgacagaccacagagccagcgtcgtctaccagacacacgtccttcaagcgccacctgcca
cggcagatgcatgtctccagtgtggactacggcaatgaactgccgccggccgccgctgaa
cagcccaccagtattggccgtatcaagcctgagctctacaagcagaagtcagtggatggg
gatgaggccaagtctgaggccgccaagagctgtgggaagatcaacttcagcctccgctat
gactatgagagtgagaccctgattgtacgaatcctgaaggcctttgacctccctgccaag
gacttttgtggaagttctgacccttacgttaaaatctacctcttgcctgaccgcaagtgc
aagctgcagacccgggtgcaccgcaagacgctgaaccccacctttgatgagaacttccac
ttccccgtgccctatgaggagctggctgaccgcaagctgcatctcagtgtctttgacttt
gaccgcttctcccgccatgacatgattggcgaggtcatcctggacaatctcttcgaggcc
tctgacctgtcccgggagacctccatctggaaggacatccagtacgctactagtgaaagt
gtggacttgggagagatcatgttctccctctgctacctgcccacagcaggcaggctcacc
ctcacggtgatcaagtgtcgcaatctcaaagcaatggatatcacgggctactcagatccc
tacgtcaaagtgtccctactatgtgatgggcggagactgaaaaagaagaaaacaaccata
aaaaagaacaccctcaaccctgtctacaacgaggccatcatctttgatatccccccagaa
aacatggatcaagtgagcctgctcatctccgttatggactatgacagagttggccacaac
gagatcataggagtgtgtagagtggggatcagtgctgaaggtcttggcagggaccactgg
aatgagatgttggcatacccacgaaagcccatcgcacactggcactgcttggcggaggta
aagaaatccttcaaagagggaaccccccggttgtga

DBGET integrated database retrieval system