KEGG   Rattus norvegicus (rat): 60568
Entry
60568             CDS       T01003                                 

Gene name
Syt11
Definition
(RefSeq) synaptotagmin 11
  KO
K19911  synaptotagmin-11
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:rno04131]
    60568 (Syt11)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Synaptotagmins
    60568 (Syt11)
SSDB
Motif
Pfam: C2 CEP76-C2 PTEN_C2
Other DBs
NCBI-GeneID: 60568
NCBI-ProteinID: NP_113855
RGD: 62042
Ensembl: ENSRNOG00000020279
UniProt: Q505J5
Position
2q34
AA seq 429 aa
MAEITNIRPSFDVSPVAAGLIGASVLVVCVSVTVFVWTCCHQQAEKKHKTPPYKFIHMLK
GISIYPETLSNKKKIIKVRRDKDGSHRESGRGNLLVNAESGLLSHDRDPRGPSPASCIDQ
LPIKRDYGEELRSPMTSLTPGESKPTSPSSPEEDVMLGSLTFSVDYNFPKKALVVTIQEA
HGLPVMDGQTQGSDPYIKMTILPDKRHRVKTRVLRKTLDPVFDETFTFYGIPYSQLQDLV
LHFLVLSFDRFSRDDVIGEVMVPLAGVDPSTGKVQLTRDIIKRNIQKCISRGELQVSLSY
QPVAQRMTVVVLKARHLPKMDITGLSDPYVKVNVYYGRKRIAKKKTHVKKCTLNPIFNES
FIYDIPTDLLPDISIEFLVIDFDRTTKNEVVGRLILGAHSVTTSGAEHWREVCESPRKPV
AKWHSLSEY
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggctgagatcacaaatatacgccccagctttgatgtgtcaccagtagcggctggcctc
atcggcgcctctgtgctggtggtgtgtgtctctgtgactgtctttgtgtggacatgctgc
caccagcaggcggagaagaagcacaagaccccaccgtacaagtttattcatatgctgaaa
ggcattagcatctacccagagaccctcagcaacaagaagaaaatcatcaaagttcggagg
gacaaagatggttctcatagggaaagtggacgagggaacctgttagtaaatgcggagtct
ggcctgctgagccatgacagggatcccagagggcctagccctgcatcttgtatagaccag
ttacccatcaaaagagactatggggaagaactgaggagccccatgaccagcctgaccccc
ggtgaaagcaagcccacctccccatcatcgccagaggaagatgtgatgctagggtccctt
accttctcggtggactacaactttcccaagaaagctctggtggtgacaatccaagaggcg
catgggctgccagtgatggatggccagacccagggctccgatccctacatcaaaatgacc
attcttcctgacaagcggcatcgagtgaagacccgggtgcttcgcaagaccctggacccc
gtgtttgatgagaccttcaccttctacggcattccctacagccagctacaggacctggtg
ctgcacttccttgtgctcagctttgatcgcttctctcgggatgacgtcatcggggaggtc
atggtgcccttggctggagtggaccccagcacaggcaaggttcagctgaccagggacatc
atcaagaggaacattcagaagtgcattagcagaggggaactccaggtatctctgtcatac
cagcccgtcgcacagagaatgacagtggtggtcctcaaagccagacacttgccgaagatg
gatatcaccggtctctcagatccttatgtcaaggtgaacgtctactacggcagaaaacgc
attgccaagaagaaaactcatgtaaagaagtgcactttgaaccccatcttcaatgagtcc
ttcatctatgacatccccaccgatctcctgcctgatatcagcatcgagttccttgtcatt
gacttcgatcgtactactaagaatgaggtggtagggaggctgatcttgggggcacacagt
gtcacaaccagtggtgcagaacactggagagaggtgtgcgagagtccccgcaagcctgta
gccaagtggcacagtctgagcgagtactaa

DBGET integrated database retrieval system