KEGG   Rattus norvegicus (rat): 60575
Entry
60575             CDS       T01003                                 

Gene name
Napsa
Definition
(RefSeq) napsin-A precursor
  KO
K08565  napsin-A [EC:3.4.23.-]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rno00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    60575 (Napsa)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:rno01002]
    60575 (Napsa)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     60575 (Napsa)
Peptidases and inhibitors [BR:rno01002]
 Aspartic peptidases
  Family A1: pepsin family
   60575 (Napsa)
SSDB
Motif
Pfam: Asp TAXi_N
Other DBs
NCBI-GeneID: 60575
NCBI-ProteinID: NP_113858
RGD: 61940
Ensembl: ENSRNOG00000019854
UniProt: Q9QX71
Position
1
AA seq 420 aa
MLPPPLLLLLCLVLLGNLEPAATLIRVPLRRIHPGHRIFSPLYGWEQRAELSRTPTSGGK
TAFVPLSKFMNTQYFGDIGLGTPPQNFTVVFDTGSSNLWVPSTRCHFFSLACWFHHRFNP
KASSSFRPNGTKFAIQYGTGRLSGILSRDNLTIGGIHNVSVTFGEALWEPSLVFALARFD
GILGLGFPTLAVGGVQPPLDALVEQRLLEKPVFSFYLNRDSEGSDGGELVLGGSDPDHYV
PPLTFIPVTIPAYWQVHMQSVKVGTGLNLCAQGCGAILDTGTSLITGPSEEIRALNKAVG
GFPLLTGQYLIQCSKIPELPTVSFSLGGVWFNLTGQDYVIKILQSDVGLCLLGFQALDIP
KPEGPLWILGDVFLGSYVAVFDRGDKNIGPRVGLARARSRATGRAERKATQAQFLRRRPG
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgttgccaccaccgctgctgctgctgctgtgcctggtgctgctggggaatttggagcct
gcggccacactgatccgagtccctcttcgccgaatccaccctggacacaggatcttcagc
ccactgtatggatgggaacagagagcagagctttctaggacccccacctccggcggcaag
accgcctttgtgcctctatccaagttcatgaacacccagtattttggagacattggtttg
ggaacgcctcctcagaatttcacagttgtctttgacacgggttcttccaacttgtgggtt
ccatccacgagatgtcatttcttcagtttggcctgctggttccaccatcgttttaatccc
aaggcctccagctcctttcggcccaatgggaccaagtttgccattcagtatgggaccggg
cggctgagtggaatcctgagccgggataatctgactatcggcggtatccacaatgtttct
gtgacctttggagaggctctgtgggagcccagcctggtctttgctttggcccgctttgat
gggatcctgggcctcggcttccccactctggctgtgggaggagttcagcctccactggac
gcactggtggagcagcgactgctggagaaacccgtcttctccttttacctcaacagggat
tctgaagggtctgatgggggagagctggtcctggggggctcggacccggatcactacgta
cctcccctcaccttcattccagtcaccatccctgcctactggcaggtccacatgcagagt
gtgaaggttggcacggggctgaatctctgcgcccagggctgtggtgccatcctagacaca
ggcacatccctcatcacgggacccagtgaggagatccgggccttgaataaggccgttggg
ggatttcccctcctgaccgggcagtacctcattcagtgttccaagatcccagagctcccc
actgtctccttctccctcggtggagtctggtttaacctcacaggtcaggactatgtcatc
aagattcttcagagtgatgttggcctctgcctgttgggcttccaagccttggacatcccc
aagcctgaaggacccctttggatcctcggggacgtctttttggggtcctatgtggccgtc
tttgaccgaggggacaaaaacatcggcccgcgcgtgggactggcgcgtgctcggtctcgt
gcaacaggacgggcagaaagaaaggctacgcaagcgcagttcctcagaagacgccctggt
tag

DBGET integrated database retrieval system