KEGG   Rattus norvegicus (rat): 60577
Entry
60577             CDS       T01003                                 

Gene name
Slc15a2
Definition
(RefSeq) solute carrier family 15 member 2
  KO
K14637  solute carrier family 15 (oligopeptide transporter), member 2
Organism
rno  Rattus norvegicus (rat)
Brite
KEGG Orthology (KO) [BR:rno00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rno02000]
    60577 (Slc15a2)
Transporters [BR:rno02000]
 Solute carrier family (SLC)
  SLC15: Proton oligopeptide cotransporter
   60577 (Slc15a2)
SSDB
Motif
Pfam: PTR2 DUF4397 DUF4714
Other DBs
NCBI-GeneID: 60577
NCBI-ProteinID: NP_113860
RGD: 61972
Ensembl: ENSRNOG00000002305
UniProt: A0A0H2UHA7 Q5U401
Structure
PDB: 
5A9H 5A9I

Position
11
AA seq 740 aa
MLEERESKEPAMNPFQKNESKETLFSPVSTEEMLPRPPSPPKKSPPKIFGSSYPVSIAFI
VVNEFCERFSYYGMKAVLTLYFLYFLHWNEDTSTSVYHAFSSLCYFTPILGAAIADSWLG
KFKTIIYLSLVYVLGHVFKSLGAIPILGGKMLHTILSLVGLSLIALGTGGIKPCVAAFGG
DQFEEEHAEARTRYFSVFYLAINAGSLISTFITPMLRGDVKCFGQDCYALAFGVPGLLMV
LALVVFAMGSKMYRKPPPEGNIVAQVIKCIWFALCNRFRNRSGDLPKRQHWLDWAAEKYP
KHLIADVKALTRVLFLYIPLPMFWALLDQQGSRWTLQANKMNGDLGFFVLQPDQMQVLNP
FLVLIFIPLFDLVIYRLISKCRINFSSLRKMAVGMILACLAFAVAALVETKINGMIHPQP
ASQEIFLQVLNLADGDVKVTVLGSRNNSLLVESVSSFQNTTHYSKLHLEAKSQDLHFHLK
YNSLSVHNDHSVEEKNCYQLLIHQDGESISSMLVKDTGIKPANGMAAIRFINTLHKDLNI
SLDTDAPLSVGKDYGVSAYRTVLRGKYPAVHCETEDKVFSLDLGQLDFGTTYLFVITNIT
SQGLQAWKAEDIPVNKLSIAWQLPQYVLVTAAEVMFSVTGLEFSYSQAPSSMKSVLQAAW
LLTVAVGNIIVLVVAQFSGLAQWAEFVLFSCLLLVVCLIFSVMAYYYVPLKSEDTREATD
KQIPAVQGNMINLETKNTRL
NT seq 2223 nt   +upstreamnt  +downstreamnt
atgcttgaggagagagagagtaaggagccagccatgaatcctttccagaaaaatgagtcc
aaggaaacgcttttttcacctgtctctactgaggagatgctgcctagacctccgagccct
ccaaagaagtcacctccgaaaatctttggctccagctacccagtcagcattgccttcatc
gtggtgaatgaattctgcgagcgattttcctattatggcatgaaagctgtgctgaccttg
tacttcctgtatttcctgcactggaatgaagacacgtccacctctgtctaccatgccttc
agcagcctctgctatttcactcccatcttgggtgcggccattgctgactcctggctggga
aaattcaagacaatcatctatctctccctggtgtatgttcttggccatgtattcaagtct
ttgggtgccataccaatactgggaggaaaaatgctacatacaatcttatcattggttggt
ctgagtctaattgctctgggaacaggaggtatcaaaccctgtgtggcagctttcggcgga
gaccagtttgaagaggaacatgcagaggcacggactagatacttctcagtcttctacctc
gccatcaatgcggggagcttgatttccacgttcatcacacccatgctgagaggagatgtg
aagtgttttggccaagactgctatgcactggcttttggagttccaggattgctcatggtg
ctggcacttgttgtgtttgcaatgggaagcaagatgtacaggaaaccacctcctgaaggg
aacatagtggctcaagttatcaaatgcatatggtttgctctctgcaaccgcttcaggaac
cgttctggggaccttccgaagcgacaacactggctagactgggcagcagaaaaatatcca
aagcatctcatcgcagatgtgaaggccctgaccagggtactgtttctttatatcccactg
cccatgttctgggcacttttggaccaacagggctcgcggtggactctgcaagctaacaag
atgaatggtgacttgggtttttttgtacttcagccggatcagatgcaggtgctaaatccc
tttctggttcttatcttcatccccttgtttgaccttgtcatttaccggctgatctccaag
tgcagaattaacttctcatcactcaggaaaatggcagttggtatgatcctagcgtgcttg
gcttttgcagttgcagcacttgtcgagacaaaaataaatggaatgatccatccccagcca
gcttcccaagagatatttttacaagtcttgaatttggcagatggtgatgtaaaggtgacc
gtgctgggcagtagaaataattctctcttggtggagtccgtcagctcttttcagaacaca
acgcactattcaaaactacacctggaggcaaagagccaagatttacattttcatctgaag
tataacagcttgtctgtccacaatgaccattctgtagaggagaagaactgttaccagctg
ctcattcaccaggacggggagagtatctccagcatgctggtcaaggatacaggaatcaaa
ccagccaatgggatggcagccatcaggtttattaacactttgcataaagacttgaacatc
tccttggatacagacgctcctctcagcgtgggcaaagactacggagtgtctgcatacaga
actgtgctaagaggaaagtatcctgcagtgcactgtgaaactgaagacaaagtcttttct
ctcgatttaggtcaactagactttggtacaacatatttgttcgtgatcactaatatcacc
agtcagggtcttcaggcctggaaggcagaggacattccagtcaataaactatccattgca
tggcagctaccacagtatgtcctggttacagcagcagaggtcatgttctcagtcacagga
cttgaattttcttattctcaggcaccatctagcatgaaatctgtgctccaggcggcctgg
ttgttgaccgttgcagttgggaatatcattgtgcttgtcgtggctcagttcagtggcctg
gcacagtgggccgagttcgttttgttttcctgcctcctcctggtggtctgcctgatcttc
tccgtcatggcctactactacgttcctctaaagtcagaagatacccgtgaggcaacagat
aagcagattcctgccgtgcaggggaatatgattaacctagaaaccaagaatacaaggctc
tga

DBGET integrated database retrieval system