KEGG   Rattus norvegicus (rat): 60587Help
Entry
60587             CDS       T01003                                 

Gene name
Dusp4, Mkp-2, Mkp2
Definition
(RefSeq) dual specificity phosphatase 4
  KO
K04459  dual specificity MAP kinase phosphatase [EC:3.1.3.16 3.1.3.48]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    60587 (Dusp4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:rno01009]
    60587 (Dusp4)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     60587 (Dusp4)
    3.1.3.48  protein-tyrosine-phosphatase
     60587 (Dusp4)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    60587 (Dusp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese Y_phosphatase CDKN3 PTPlike_phytase Myotub-related
Motif
Other DBs
NCBI-GeneID: 60587
NCBI-ProteinID: NP_071535
RGD: 620625
Ensembl: ENSRNOG00000011921
UniProt: Q62767
Position
16q12.2
AA seq 395 aa AA seqDB search
MVTMEELREMDCSVLKRLMNRDENGGTAGSSGGSHGALGLLSGGKCLLLDCRPFLAHSAG
YIRGSVNVRCNTIVRRRAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLR
EDSTVSLVVQALRRNAERTDICLLKGGYERFSSEYPEFCSKTKALAAIPPPVPPSTNESL
DLGCSSCGTPLHDQGGPVEILPFLYLGSAYHAARRDMLDALGITALLNVSSDCPNHFEGH
YQYKCIPVEDNHKADISSWFMEAIEYIDAVKDCRGRVLVHCQAGISRSATICLAYLMMKK
RVRLEEAFEFVKQRRSIISPNFSFMGQLLQFESQVLTTSCAAEAASPSGPLRERGKATPT
PTSQFVFSFPVSVGVHAAPSNLPYLHSPITTSPSC
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtgacgatggaggaactgcgggagatggactgcagcgtgctcaaaaggctgatgaac
cgagatgagaacggcggcacggcgggcagcagcggcggcagccacggcgccctggggctg
ctgagcggcggcaagtgcttgctgctggactgcaggccgtttctggctcacagcgcgggc
tacatccgaggctcggtgaacgtgcgctgcaataccatcgtgcggcggagggccaagggc
tccgtgagcctggagcagattctgcccgccgaggaagaggtgcgcgcccgcctgcgctct
ggcctctactcggctgtcatcgtctacgatgagcgcagcccgcgcgccgagagtctccgg
gaggacagcacagtgtcgctggtcgtgcaggcgttgcgccggaacgcggagcgcacagac
atctgcctgcttaaaggtggctatgagaggttttcttctgagtacccagaattctgctct
aaaactaaggccctggccgccatcccaccccccgtacctcccagcacaaatgagtccttg
gatctgggctgcagctcctgtgggaccccactgcacgaccaggggggtcctgtggagatc
cttcctttcctctacctcggcagtgcctaccacgctgcccgcagggacatgcttgatgcc
ctggggatcacggctctactgaatgtctcctcagactgccccaatcactttgagggacat
taccagtacaagtgcatcccggtagaagataaccacaaggctgacatcagctcctggttc
atggaagccatcgaatacatagacgcagtgaaggactgccgagggcgagtgctggttcac
tgccaggccggcatctctagatcagccaccatctgcctggcctacctgatgatgaagaaa
cgggtgaggctggaggaggctttcgagttcgtcaagcagcgccgtagcatcatctcgccc
aacttcagcttcatgggccagttgctgcagttcgagtctcaggtgctcaccacgtcctgc
gcagcggaggccgccagcccttccgggcccctgcgggagagggggaaggccactcccacc
cccacctcgcagttcgtcttcagcttccccgtgtccgtgggtgtgcacgcggctcccagt
aacctgccgtacctgcacagccccatcaccacctcccccagctgttag

DBGET integrated database retrieval system