KEGG   Rattus norvegicus (rat): 60628
Entry
60628             CDS       T01003                                 

Gene name
Cxcr4
Definition
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04020  Calcium signaling pathway
rno04060  Cytokine-cytokine receptor interaction
rno04061  Viral protein interaction with cytokine and cytokine receptor
rno04062  Chemokine signaling pathway
rno04144  Endocytosis
rno04360  Axon guidance
rno04670  Leukocyte transendothelial migration
rno04672  Intestinal immune network for IgA production
rno04810  Regulation of actin cytoskeleton
rno05163  Human cytomegalovirus infection
rno05170  Human immunodeficiency virus 1 infection
rno05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    60628 (Cxcr4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    60628 (Cxcr4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    60628 (Cxcr4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    60628 (Cxcr4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60628 (Cxcr4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    60628 (Cxcr4)
   04672 Intestinal immune network for IgA production
    60628 (Cxcr4)
   04062 Chemokine signaling pathway
    60628 (Cxcr4)
  09158 Development and regeneration
   04360 Axon guidance
    60628 (Cxcr4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60628 (Cxcr4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    60628 (Cxcr4)
   05163 Human cytomegalovirus infection
    60628 (Cxcr4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:rno04030]
    60628 (Cxcr4)
   04050 Cytokine receptors [BR:rno04050]
    60628 (Cxcr4)
   04090 CD molecules [BR:rno04090]
    60628 (Cxcr4)
G protein-coupled receptors [BR:rno04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    60628 (Cxcr4)
Cytokine receptors [BR:rno04050]
 Chemokine receptors
  CXC Chemokine
   60628 (Cxcr4)
CD molecules [BR:rno04090]
 Proteins
  60628 (Cxcr4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros COX2_TM
Other DBs
NCBI-GeneID: 60628
NCBI-ProteinID: NP_071541
RGD: 620465
Ensembl: ENSRNOG00000003866
UniProt: O08565
Position
13
AA seq 349 aa
MEIYTSDNYSEEVGSGDYDSNKEPCFRDENENFNRIFLPTIYFIIFLTGIVGNGLVILVM
GYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAMADWYFGKFLCKAVHIIYTVNLYSS
VLILAFISLDRYLAIVHATNSQRPRKLLAEKAVYVGVWIPALLLTIPDIIFADVSQGDGR
YICDRLYPDSLWMVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKTTVI
LILAFFACWLPYYVGISIDSFILLEVIKQGCEFESVVHKWISITEALAFFHCCLNPILYA
FLGAKFKSSAQHALNSMSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggaaatatacacttcggataactactccgaagaagtagggtctggagactatgactcc
aacaaggaaccctgcttccgggatgaaaacgaaaacttcaacaggatcttcctgcccacc
atctattttatcatcttcttgactggcatagtgggcaatgggttggtaatcctggtcatg
ggttaccagaagaagctgaggagcatgacagacaagtaccggctgcacctgtccgtggct
gacctcctctttgtcatcacactccccttctgggcagtggacgccatggctgactggtac
tttgggaaatttttatgtaaggctgtgcatatcatctacaccgtcaacctttacagcagt
gttctcatcctggccttcatcagcctggaccgctaccttgccattgtccacgccaccaac
agccagaggccgaggaagctgctggctgaaaaggccgtctatgtgggtgtctggatcccc
gccctcctcctgactatccctgacatcatcttcgccgatgtcagccagggggacggcagg
tacatctgtgaccgcctttaccccgacagcctgtggatggtggtgttccagttccagcac
atcatggtgggtctcatcctgccgggcatcgtcatcctgtcctgttactgcatcatcatc
tccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagactacggtcatc
cttatcctggctttctttgcctgctggctaccgtattacgtggggatcagcatcgattcc
ttcatccttttggaggtcatcaagcaaggatgtgagttcgagagcgtcgtgcacaagtgg
atctccatcacggaggccctcgccttcttccactgttgcctgaaccccatcctctacgcc
ttcctcggggccaaattcaagagctccgcgcagcatgcactcaattccatgagcagaggc
tccagcctcaagatcctttccaaagggaaacggggtggacactcttccgtctccacagag
tcagaatcctcaagttttcactccagctaa

DBGET integrated database retrieval system