KEGG   Rattus norvegicus (rat): 60629Help
Entry
60629             CDS       T01003                                 

Gene name
Unc5a, Unc5h1
Definition
(RefSeq) unc-5 netrin receptor A
  KO
K07521  netrin receptor unc-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    60629 (Unc5a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death TSP_1 Ig_3 I-set Ig_2 ig
Motif
Other DBs
NCBI-GeneID: 60629
NCBI-ProteinID: NP_071542
RGD: 621755
Ensembl: ENSRNOG00000059840
UniProt: O08721
Position
17p14
AA seq 898 aa AA seqDB search
MAVRPGLWPVLLGIVLAAWLRGSGAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDSSSGLPTMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSTSAAVIVY
VNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGS
WSSWSKWSACGLDCTHWRSRECSDPAPRNGGEECRGADLDTRNCTSDLCLHTASCPEDVA
LYIGLVAVAVCLFLLLLALGLIYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLL
TIQPDLSTTTTTYQGSLCSRQDGPSPKFQLSNGHLLSPLGSGRHTLHHSSPTSEAEDFVS
RLSTQNYFRSLPRGTSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHK
PEDVRLPLAGCQTLLSPVVSCGPPGVLLTRPVILAMDHCGEPSPDSWSLRLKKQSCEGSW
EDVLHLGEESPSHLYYCQLEAGACYVFTEQLGRFALVGEALSVAATKRLRLLLFAPVACT
SLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLW
KSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERINASTSDLACKVWVWQVEGDGQSFNINF
NITKDTRFAELLALESEGGVPALVGPSAFKIPFLIRQKIIASLDPPCSRGADWRTLAQKL
HLDSHLSFFASKPSPTAMILNLWEARHFPNGNLGQLAAAVAGLGQPDAGLFTVSEAEC
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggccgtccggcccggcctgtggccagtgctcctgggcatagtcctcgccgcctggctt
cgtggttcgggtgcccagcagagtgccacggtggccaatccagtgcccggtgccaacccc
gacctgctgccccacttcctggtagagcctgaggacgtgtacattgtcaagaacaagccg
gtgttgttggtgtgcaaggctgtgcctgccacccagatcttcttcaagtgcaatggggaa
tgggtccgccaggtcgatcacgtaattgaacgcagcaccgacagcagcagcggattgcca
accatggaggtccgtatcaacgtatcgaggcagcaggtagagaaagtgtttgggctggag
gaatactggtgccagtgtgtggcatggagctcctcgggtaccaccaaaagtcagaaggcc
tacatccggattgcctatttgcgcaagaactttgagcaggagccactggccaaggaagtg
tcactggagcaaggcattgtactaccttgtcgccccccagaaggaatccccccagctgag
gtggagtggcttcgaaatgaggacctcgtggacccctccctcgatcccaatgtgtacatc
acgcgggagcacagcctagtcgtgcgtcaggcccgcctggccgacacggccaactacacc
tgtgtggccaagaacatcgtagcccgtcgccgaagcacctctgcagcggtcattgtttat
gtgaacggtgggtggtcgacgtggactgagtggtccgtctgcagcgccagctgtgggcgt
ggctggcagaaacggagccggagctgcaccaacccggcacctctcaacgggggcgccttc
tgtgaggggcagaatgtccagaaaacagcctgcgccactctgtgcccagtggatgggagc
tggagttcgtggagtaagtggtcagcctgtgggcttgactgcacccactggcggagccgc
gagtgctctgacccagcaccccgcaatggaggtgaggagtgtcggggtgctgacctggac
acccgcaactgtaccagtgacctctgcctgcacaccgcttcttgccccgaggacgtggct
ctctacatcggccttgtcgctgtggctgtgtgcctcttcttgctgttgctggcccttgga
ctcatttactgtcgcaagaaggaagggctggactccgatgtggccgactcgtccatcctc
acctcgggcttccagcctgtcagcatcaagcccagcaaagcagacaacccccacctgctc
accatccagccagacctcagcaccaccactaccacctaccagggcagtctatgttcgagg
caggatggacccagccccaagttccagctctctaatggtcacctgctcagcccactgggg
agtggccgccatacgttgcaccacagctcacccacctctgaggctgaggacttcgtctcc
cgcctctccacccaaaactactttcgttccctgccccgcggcaccagcaacatggcctac
gggaccttcaacttcctcgggggccggctgatgatccctaatacggggatcagcctcctc
atacccccggatgccatcccccgaggaaagatctacgagatctacctcacactgcacaag
ccagaagacgtgaggttgcccctagctggctgtcagaccctgctgagtccagtcgttagc
tgtgggcccccaggagtcctgctcacccggccagtcatccttgcaatggaccactgtgga
gagcccagccctgacagctggagtctgcgcctcaaaaagcagtcctgcgagggcagttgg
gaggatgtgctgcaccttggtgaggagtcaccttcccacctctactactgccagctggag
gccggggcctgctatgtcttcacggagcagctgggccgctttgccctggtaggagaggcc
ctcagcgtggctgccaccaagcgcctcaggctccttctgtttgctcccgtggcctgtacg
tcccttgagtacaacatccgagtgtactgcctacacgacacccacgacgctctcaaggag
gtggtgcagctggagaagcagctaggtggacagctgatccaggagcctcgcgtcctgcac
ttcaaagacagttaccacaacctacgtctctccatccacgacgtgcccagctccctgtgg
aagagcaagctacttgtcagctaccaggagatccctttttaccacatctggaacggcacc
cagcagtatctgcactgcaccttcaccctggagcgcatcaacgccagcaccagcgacctg
gcctgcaaggtgtgggtgtggcaggtggagggagatgggcagagcttcaacatcaacttc
aacatcactaaggacacaaggtttgctgaattgttggctctggagagtgaagggggggtc
ccagccctggtgggccccagtgccttcaagatccccttcctcattcggcaaaagatcatc
gccagtctggacccaccctgcagccggggcgccgactggagaactctagcccagaaactt
cacctggacagccatcttagcttctttgcctccaagcccagccctacagccatgatcctc
aacctatgggaggcacggcacttccccaacggcaacctcggccagctggcagcagctgtg
gccggactgggccaaccagatgctggcctcttcacggtgtcggaggccgagtgttga

DBGET integrated database retrieval system