KEGG   Rattus norvegicus (rat): 60630Help
Entry
60630             CDS       T01003                                 

Gene name
Unc5b, Unc5h2
Definition
(RefSeq) unc-5 netrin receptor B
  KO
K07521  netrin receptor unc-5
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:rno00001]
 09150 Organismal Systems
  09158 Development
   04360 Axon guidance
    60630 (Unc5b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UPA ZU5 Death I-set Ig_3 TSP_1 Ig_2 ig CDC24_OB3
Motif
Other DBs
NCBI-GeneID: 60630
NCBI-ProteinID: NP_071543
RGD: 621756
Ensembl: ENSRNOG00000000567
UniProt: O08722
Structure
PDB: 

Position
20q11
AA seq 945 aa AA seqDB search
MRARSGARGALLLALLLCWDPTPSLAGIDSGGQALPDSFPSAPAEQLPHFLLEPEDAYIV
KNKPVELHCRAFPATQIYFKCNGEWVSQKGHVTQESLDEATGLRIREVQIEVSRQQVEEL
FGLEDYWCQCVAWSSSGTTKSRRAYIRIAYLRKNFDQEPLAKEVPLDHEVLLQCRPPEGV
PVAEVEWLKNEDVIDPAQDTNFLLTIDHNLIIRQARLSDTANYTCVAKNIVAKRRSTTAT
VIVYVNGGWSSWAEWSPCSNRCGRGWQKRTRTCTNPAPLNGGAFCEGQACQKTACTTVCP
VDGAWTEWSKWSACSTECAHWRSRECMAPPPQNGGRDCSGTLLDSKNCTDGLCVLNQRTL
NDPKSRPLEPSGDVALYAGLVVAVFVVLAVLMAVGVIVYRRNCRDFDTDITDSSAALTGG
FHPVNFKTARPSNPQLLHPSAPPDLTASAGIYRGPVYALQDSADKIPMTNSPLLDPLPSL
KIKVYDSSTIGSGAGLADGADLLGVLPPGTYPGDFSRDTHFLHLRSASLGSQHLLGLPRD
PSSSVSGTFGCLGGRLTIPGTGVSLLVPNGAIPQGKFYDLYLRINKTESTLPLSEGSQTV
LSPSVTCGPTGLLLCRPVVLTVPHCAEVIAGDWIFQLKTQAHQGHWEEVVTLDEETLNTP
CYCQLEAKSCHILLDQLGTYVFTGESYSRSAVKRLQLAIFAPALCTSLEYSLRVYCLEDT
PAALKEVLELERTLGGYLVEEPKTLLFKDSYHNLRLSLHDIPHAHWRSKLLAKYQEIPFY
HVWNGSQKALHCTFTLERHSLASTEFTCKVCVRQVEGEGQIFQLHTTLAETPAGSLDALC
SAPGNAATTQLGPYAFKIPLSIRQKICNSLDAPNSRGNDWRLLAQKLSMDRYLNYFATKA
SPTGVILDLWEARQQDDGDLNSLASALEEMGKSEMLVAMTTDGDC
NT seq 2838 nt NT seq  +upstreamnt  +downstreamnt
atgagggcccggagcggggcgcggggcgcgctgctgctggcgctgctgctctgctgggat
ccgacaccgagcttagcaggcattgactctggtggccaggcactcccagactccttccca
tcagcacccgcggagcagctgcctcacttcctgctggaaccagaggatgcctacatcgta
aagaacaagccagtggaattgcactgccgagccttccctgccacacagatctacttcaag
tgtaatggcgagtgggttagccagaaaggccacgtcacgcaggagagcctggatgaggcc
acaggcttgcgaatacgagaggtgcagatagaggtgtcgcggcagcaggtggaggaactt
tttgggctcgaggactactggtgtcagtgcgtggcctggagctcttcgggaaccaccaag
agtcgccgagcctacatccgcattgcctacttgcgcaagaactttgaccaggagcctctg
gcgaaggaggtacccttggatcatgaggtccttctgcagtgccgcccaccagagggagtg
cctgtggctgaggtggaatggctcaagaatgaagatgtcatcgatcccgctcaggacact
aacttcctgctcaccattgaccacaacctcatcatccgccaggcgcgcctctcagacaca
gccaactacacctgtgtggcaaagaatattgtggccaagcgccggagcacgacggccaca
gtcatcgtctatgtgaacggaggttggtccagctgggcagaatggtcaccctgctctaac
cgctgcggccgaggttggcagaaacgtactaggacctgcaccaacccagccccactcaat
ggaggtgccttctgcgagggacaggcttgccagaagacggcttgcaccaccgtgtgccca
gtggatggagcgtggactgagtggagcaagtggtccgcctgcagcacagagtgtgcgcac
tggcgcagccgcgagtgcatggcaccgccgccccagaacggaggccgtgactgcagcggg
acgctacttgactccaagaactgcaccgatgggctgtgcgtgctgaatcagagaactcta
aacgaccctaaaagccgccccctggagccgtcgggagacgtggcgctgtatgcgggcctc
gtggtggccgtctttgtggttctggcagttctcatggctgtaggagtgatcgtgtaccgg
agaaactgccgggacttcgacacggacatcactgactcctctgctgccctcactggtggt
ttccaccccgtcaacttcaagactgcaaggcccagcaacccacagctcctgcacccatcc
gcccctccggacctaacggccagtgctggcatctaccgcggacctgtgtatgccctgcag
gactctgccgacaagatccctatgactaattcaccccttctggatcccttgcccagcctc
aagatcaaggtctatgactccagcaccatcggctctggggctggcctggctgatggagcc
gacctgctgggtgtcttaccacccggtacatacccaggcgatttctcccgggacacccac
ttcctgcacctgcgcagcgccagccttggttcccagcacctcctgggcctccctcgagac
cccagcagcagtgtcagtggcacctttggttgcctgggtgggaggctgaccattcccggc
acaggggtcagcctgttggtaccaaatggagccattccccagggcaagttctatgacttg
tatctacgtatcaacaagactgaaagcaccctcccactttcggaaggttcccagacagta
ttgagcccctcggtgacctgcgggcccacgggcctcctcctgtgccgccctgttgtcctc
actgtgccccactgtgctgaagtcattgccggagactggatcttccagctcaagacccag
gcccatcagggccactgggaggaggtggtgactttggatgaggagactctgaacaccccc
tgctactgccagctagaggctaaatcctgccacatcctgttggaccagctgggtacctac
gtgttcacgggcgagtcctactcccgctccgcagtcaagcggctccagctagccatcttc
gccccagccctctgcacctccctggagtatagtctcagggtctactgtctggaggacact
cctgcagcactgaaggaggtcctagagctggagaggactctgggtggctacttggtggag
gagcccaagactttgctctttaaggacagttaccacaacctacgnctctccctccatgac
atcccccatgcccactggaggagcaaactactggccaagtaccaggagattcccttctac
catgtgtggaacggcagccagaaagccctgcactgcactttcaccctggagagacatagc
ctagcctccactgagttcacctgtaaggtctgcgtgcggcaggtagaaggggaaggccag
attttccagctgcacaccacgctggctgagacgcctgctggctccctggatgcactctgc
tctgcccctggcaatgctgccaccacacagctgggaccctatgccttcaagataccactg
tccatccgccagaagatctgcaacagcctggacgcccccaactcacggggcaatgactgg
cggctgttggcacagaagctctccatggaccggtacctgaactacttcgccaccaaagct
agtcccacaggcgtgatcttagacctctgggaagctcggcagcaggatgatggggacctc
aacagcctggccagtgccttggaggagatgggcaagagtgagatgctggtagccatgacc
actgatggcgattgctga

DBGET integrated database retrieval system