KEGG   Rattus norvegicus (rat): 60662Help
Entry
60662             CDS       T01003                                 

Gene name
Fgf5
Definition
(RefSeq) fibroblast growth factor 5
  KO
K04358  fibroblast growth factor
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04010  MAPK signaling pathway
rno04014  Ras signaling pathway
rno04015  Rap1 signaling pathway
rno04151  PI3K-Akt signaling pathway
rno04810  Regulation of actin cytoskeleton
rno05200  Pathways in cancer
rno05218  Melanoma
rno05224  Breast cancer
rno05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    60662 (Fgf5)
   04015 Rap1 signaling pathway
    60662 (Fgf5)
   04010 MAPK signaling pathway
    60662 (Fgf5)
   04151 PI3K-Akt signaling pathway
    60662 (Fgf5)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    60662 (Fgf5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    60662 (Fgf5)
  09162 Cancer: specific types
   05226 Gastric cancer
    60662 (Fgf5)
   05218 Melanoma
    60662 (Fgf5)
   05224 Breast cancer
    60662 (Fgf5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:rno04052]
    60662 (Fgf5)
   00536 Glycosaminoglycan binding proteins [BR:rno00536]
    60662 (Fgf5)
Cytokines and growth factors [BR:rno04052]
 Growth factors
  Growth factors (RTK binding)
   60662 (Fgf5)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   60662 (Fgf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 60662
NCBI-ProteinID: NP_071547
RGD: 620129
Ensembl: ENSRNOG00000022631
UniProt: P48807
Position
14p22
AA seq 266 aa AA seqDB search
MSLSLLFLIFCSHLILSAPAQGEKRLTPEGQPAPPRNPGDSSGSRGRSSATFASSSASSP
VAASPGSQGSGSEHSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASVLSILE
IFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTE
KTGREWYVALNKRGKAKRGCSPRVKPQHVSTHFLPRFKQSEQPELSFTVTVPEKKKPPRP
WKPKVPLSPSRRSPSPVKYRLKFRFG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgtccttgctcttcctcatcttctgcagccacctgatcctcagcgctccggct
caaggggagaagcgtctcactcccgaagggcaacccgcgcctcctaggaacccgggagac
tccagcggcagccggggcagaagtagcgcgacgtttgcttcgtcttctgcctcttcccca
gtcgcagcttctccgggcagccaaggaagcggctcggagcacagcagtttccagtggagc
ccttcggggcgccggaccggcagcctgtactgcagagtgggcatcggtttccatctgcag
atctacccggatggcaaagtcaatggatcccacgaagccagtgtgttaagtattttggaa
atatttgctgtgtctcaggggattgtaggaatacgaggagttttcagcaacaaattttta
gcgatgtcaaaaaaaggaaaactccatgcaagtgccaaatttacagatgactgtaagttc
agggagagattccaagaaaacagctataatacctatgcgtcagcgattcacagaactgaa
aagacaggccgggagtggtatgtggccctgaacaagagagggaaagccaaaagaggctgc
agcccacgggtcaaaccccagcacgtctccacccacttcctacccaggttcaagcagtcc
gagcaaccggaactttccttcaccgtcactgttccagaaaagaaaaagccacctaggccc
tggaaaccaaaggttcccctgtcgccatctcgtagaagccccagtccagtgaagtacaga
ctgaagtttcgcttcggatga

DBGET integrated database retrieval system